Supplementary Figures Supplementary Fig. 1. Comparison of the number of genes, exons and genome size (in Mb) in 12 arthropod genomes (based on EnsemblGenomes release 12). Supplementary Fig. 2. (a) Comparison of the number of genes and their average length in 12 arthropod genomes (based on EnsemblGenomes release 12). (b) Comparison of the number of exons and their average length in 12 arthropod genomes (based on EnsemblGenomes release 12). Supplementary Fig. 3. (a) Comparison of the number of introns and their average length in 12 arthropod genomes (based on EnsemblGenomes release 12). (b) Comparison of the genome size and and average intron length in 12 arthropods genomes (based on EnsemblGenomes release 12). Supplementary Fig. 4. BAC mapping to I. scapularis genome scaffolds. Annotated scaffolds were mapped to 45 sequenced BACs to assess the level of representation in the current annotated assembly. (a): Nucmer alignments of all BACs (x axis) to IscW annotated scaffolds (y axis). (b, c and d): Individual BAC sequences represented in two or more IscW scaffolds (b), BAC sequence does not align significantly to any scaffold (b) and BAC sequence is represented by a single IscW scaffold (c). All mappings are shown in Supplementary Table 4. Supplementary Fig. 5. Alignment of Ixodes scapularis Expressed Sequence Tag (EST) and cDNA sequences to IscaW1 scaffolds. The I. scapularis EST set, comprising 193,151 EST and cDNA sequences, was aligned to the IscaW1 scaffold sequences and assembled. EST sequences were utilized to generate high quality training sets and improve gene structures. ESTs assembled using PASA, were aligned to the core scaffolds representing the annotated genome. ESTs were also used to evaluate and capture potential genes in small contigs that were not initially included in the annotated scaffolds. EST hits to small contigs that are not part of the annotated scaffolds typically represent transcripts derived from transposable elements such as non-LTR type elements, and do not contain an open reading frame. [Type a quote from the document or the summary of an interesting point. You can position the text box anywhere in the document. Use the Text Box Tools tab to change the formatting of the pull quote text box.] Supplementary Fig. 6. Functional analysis of the Ixodes scapularis IscaW1 gene models showing the gene ontology results for: (a) Biological Process (b) Cellular Component and (c) Molecular Function categories. Multi-level pie charts show all GO terms that exceed the cut-off value of 1,000 sequences. Numbers in parentheses indicate the total number of sequences assigned to a specific GO term. Supplementary Fig. 7. Schematic showing the strategy employed for the identification of all LTR retrotransposons in the genome of Ixodes scapularis. b. Identification of LTR elements. b. Phylogenetic analysis. C. Identification of the number of copies of each LTR retrotransposon. Circles indicate databases used for searches. Rectangles indicate input/output files and. Programs used are written in bold beside arrows. See Supplementary text for details. CCD = Conserved Domain Database, RT = Retrotranscriptase; RH = Ribonuclease; INT = Integrase. Supplementary Fig. 8. New Ty3/gypsy lineages in the genome of Ixodes scapularis. Phylogenetic relationships between the Ty3/gypsy retrotransposons of Ixodes scapularis and insect genomes inferred by the NJ method and based on the conserved domains of RT, RnaseH, and INT51. Bootstrap values (1,000 replications) supporting the clusters of each lineage of the Ty3/gypsy family are shown. Names of Ty3/gypsy lineages are shown in capitals. Two new lineages (named Toxo and Squirrel; indicated by asterisk) are supported by bootstrap values of 99%. The phylogeny contains elements from Ixodes scapularis (red branches), Drosophila melanogaster, Anopheles gambiae, Aedes aegypti, and Culex pipiens. Non-insect representative elements in the phylogeny are the retrotransposons Ty3 from the yeast Saccharomyces cerevisiae, Cyclops from the plant Vicia faba, and Cer1 from the Nematoda Caenorhabditis elegans. Supplementary Fig. 9. Ixodes scapularis gene orthology and homology across Arthropoda. Orthologous and homologous relations between I. scapularis genes and those from other sequenced arthropods were examined using orthologous groups delineated across 87 arthropod species from www.OrthoDB.org25 (release 8). About 30% of I. scapularis genes have recognizable orthologs in all or almost all of the representative species selected from nine different arthropod lineages (green fractions, at least 13 of the 14 species - single-copy or with duplications). A further ~30% of I. scapularis genes are less widely conserved across Arthropoda (blue fractions, present in 2-12 of the 14 species, or present in at least one of the 73 other arthropods). Of the remaining I. scapularis genes with no identifiable orthology, about half exhibit homology (e-value <1e-05) to genes from the other 86 arthropods or to other I. scapularis genes (yellow fractions, homology to other arthropod genes or homology only to other genes in the same genome). The two chelicerates show very similar fractions of genes that currently have no significant homologs in other arthropod genomes, so-called “orphan” genes. The major fractions of the two chelicerate species’ gene sets are labeled with the corresponding percentages of their total gene counts. Supplementary Fig. 10. The organization of the mitochondrial genome of Ixodes scapularis (a), and comparison of mitochondrial gene arrangement between I. scapularis and other ticks and arthropods (b). (a) Genes are shown as boxes and were drawn approximately to scale. Arrows indicate the orientation of transcription. Protein-coding and rRNA genes are abbreviated as atp6 and atp8 (for ATP synthase subunits 6 and 8), cox1-3 (for cytochrome c oxidase subunits 1-3), cob (for cytochrome b), nad1-6 and 4L (for NADH dehydrogenase subunits 1-6 and 4L), and rrnL and rrnS (for large and small rRNA subunits). tRNA genes are shown with the single-letter abbreviations of their corresponding amino acids. The two tRNA genes for leucine are L1 (anti-codon sequence UAG) and L2(UAA), and those for serine are S1(UCU) and S2(UGA). CR is the abbreviation for the putative control region. (b) The circular mitochondrial genomes are linearized at the 5' end of cox1 (for the purpose of illustration). Genes and putative control regions (CR) are shown as boxes but were not drawn to scale. Genes are transcribed from left to right except those underlined, which are transcribed from right to left. Putative control regions are highlighted in black. Dark, grey, shaded-boxes indicate genes that changed position relative to the putative ancestor of arthropods. Pale, grey, shaded-boxes indicate genes that changed both position and the orientation-of-transcription, relative to the putative ancestor of arthropods. Supplementary Fig. 11. Introns in single-copy orthologs across 12 species. Introns were mapped on to the protein sequence alignments of 524 Strict Single-Copy (SSC) orthologs and 1,529 Relaxed Single-Copy (RSC) orthologs, allowing for small splice site changes, and conserved regions with an intron in at least one species were identified by requiring >30% amino acid identity in the aligned blocks flanking the intron position. Between 32% and 52% of introns in each species are located in well-aligned core regions of the ortholog alignments and therefore may be compared across the 12 species, and examining SSC or RSC sets does not affect the proportions of informative introns. Abbreviations: NVECT, Nematostella vectensis; HSAPI, Homo sapiens; MMUSC, Mus musculus; GGALL, Gallus gallus; DRERI, Danio rerio; ISCAP, Ixodes scapularis; DPULE, Daphnia pulex; PHUMA, Pediculus humanus; NVITR, Nasonia vitripennis; TCAST, Tribolium castaneum; AGAMB, Anopheles gambiae; DMELA, Drosophila melanogaster. Supplementary Fig. 12. 12-species phylogeny based on the conservation of intron positions. Euclidean distance matrices from presence/absence matrices for 4,621 Strict Single-Copy (SSC, a & b) and 13,459 Relaxed Single-Copy (RSC, c & d) ortholog intron positions were employed to construct phylogenetic trees using Unweighted Pair Group Method with Arithmetic Mean (UPGMA, a & c) and Neighbor Joining (NJ, b & d) algorithms. I. scapularis (ISCAP) consistently shows greater similarity to the outgroup species (red), human, mouse, chicken, zebrafish and sea anemone, than to the pancrustaceans (blue). Bootstrap values are indicated for the two nodes on each tree with less than 100% support: the alternative topologies cluster PHUMA and NVITR together and/or swap the positions of DRERI and GGALL. Unrooted radial trees are presented at the lower left of each panel. Abbreviations: NVECT, Nematostella vectensis; HSAPI, Homo sapiens; MMUSC, Mus musculus; GGALL, Gallus gallus; DRERI, Danio rerio; ISCAP, Ixodes scapularis; DPULE, Daphnia pulex; PHUMA, Pediculus humanus; NVITR, Nasonia vitripennis; TCAST, Tribolium castaneum; AGAMB, Anopheles gambiae; DMELA, Drosophila melanogaster. Supplementary Fig. 13. Intron gain/loss estimates across the 12-species phylogeny. Analysis of intron gain and loss across the 12-species phylogeny for the Strict Single-Copy (SSC) and Relaxed Single-Copy (RSC) sets of orthologs using Dollo Parsimony (DP) and Posterior Probability (PP) methods implemented in the MALIN suite for maximum likelihood analysis of intron evolution in eukaryotes33. Data are normalized by the maximum number of introns (always NVECT) in order to compare the estimates from different sets using different methods. Normalization: Gained, Lost, or Present Introns / Maximum number of Introns. NB: the scale for the normalized gain and loss estimates (0.0-0.5) is double that of the normalized presence data (0.0-1.0). Corresponding numbers are presented in Supplementary Table 9. Abbreviations: NVECT, Nematostella vectensis; HSAPI, Homo sapiens; MMUSC, Mus musculus; GGALL, Gallus gallus; DRERI, Danio rerio; ISCAP, Ixodes scapularis; DPULE, Daphnia pulex; PHUMA, Pediculus humanus; NVITR, Nasonia vitripennis; TCAST, Tribolium castaneum; AGAMB, Anopheles gambiae; DMELA, Drosophila melanogaster. Supplementary Fig. 14. Intron length distributions across 12 species. The length distributions of informative introns for the Relaxed Single-Copy (RSC) orthology sets are plotted: RSC All, all informative introns; RSC Shared, informative introns found in ISCAP and DPULE and at least one non-arthropod and at least one insect. Boxes indicate the median, 1st and 3rd quartiles, and whiskers show up to 1.5 times the interquartile range, box heights are proportional to the number of introns. I. scapularis (ISCAP) introns are most similar to those of MMUSC and other vertebrates, and more than an order of magnitude longer than pancrustacean introns. NVECT, HSAPI, MMUSC, GGALL, DRERI, and ISCAP scale to 10,000 bp (green axis) while the pancrustaceans scale to 1,000 bp (blue axis). The numbers, along with Wilcoxon test results, are presented in Supplementary Table 10. Abbreviations: NVECT, Nematostella vectensis; HSAPI, Homo sapiens; MMUSC, Mus musculus; GGALL, Gallus gallus; DRERI, Danio rerio; ISCAP, Ixodes scapularis; DPULE, Daphnia pulex; PHUMA, Pediculus humanus; NVITR, Nasonia vitripennis; TCAST, Tribolium castaneum; AGAMB, Anopheles gambiae; DMELA, Drosophila melanogaster. Supplementary Fig. 15. Heme synthesis pathways and heme synthesis genes identified in the Ixodes scapularis genome. Candidate heme synthesis genes identified in the I. scapularis genome are shown in red. The VectorBase accession numbers for each of the putative I. scapularis heme synthesis genes are listed in Supplementary Table 20. Supplementary Fig. 16. Schematic representation of putative CPs and Vgs detected in Ixodes scapularis genome compared to the confirmed counterparts from Dermacentor variabilis. DUF1943: a domain of unknown function, LPD_N: lipid binding domain, SP: signal peptide, vWD: von Willebrand type D domain. Arrows represent the RXXR location while vertical solid lines represent the GL/ICG domain location. Amino acid sequence shown represents the N-terminal sequence of the 2 CP subunits starting directly downstream of the signal peptide and the RXXR cleavage sites. Dash lines represent missing sequences. DvCP1 (ABD83654), DvVg1 (AAW78577), DvVg2 (ABW82681), IsCP1 (ISCW021709), IsCP2 (ISCW014675), IsCP3 (ISCW021710), IsCP4 (ISCW012424), IsCP5 (ISCW012423), IsCP6 (ISCW021704), IsCP7 (ISCW021707), IsCP8 (ISCW021706), IsCP9 (ISCW021705), IsCP10 (ISCW024299), IsVg1 (ISCW013727), IsVg2 (ISCW021228). Supplementary Fig. 17. Cytochrome P450 genes orthologous to the Halloween genes that encode steroidogenic cytochrome P450s for hydroxylations of 20- hydroxylecdysone. Blue font indicates the VectorBase accession number for the corresponding predicted protein sequences identified in the I. scapularis genome. Solid circles at branch points indicate bootstrapping support with higher than 70% in 1000 replication of the neighbor-joining tree. Insect genes in the orthologous group are from Tribolium castaneum (Tcas), Drosophila melanogaster (Dmel), Apis mellifera (Amel), and Daphnia pulex (Dpul). Dmel CYP302A1 Dpul CYP302A1 Amel CYP302A1 ISCW021011 ISCW001527 Dpul CYP314A1 Dmel CYP314A1 Amel CYP314A1 Tcas CYP314A1 ISCW021866 Dpul CYP315A1 Dmel CYP315A1 Amel CYP315A1 Tcas CYP315A1 Dmel CYP306A1 Amel CYP306A1 DpulCYP306A1 ISCW024795 Tcas CYP307B1 Amel CYP307B1 Dmel CYP307A1 Dmel CYP307A2 Tcas CYP307A1 Dpul CYP307A1 ISCW006980 Spook Spookier Phantom Disembodied Shade Shadow Supplementary Fig. 18. The mevalonate/farnesoic acid pathway in Ixodes scapularis. Genes encoding enzymes highlighted in red were identified in the I. scapularis genome. There is no evidence that putative I. scapularis methyl transferases are involved in the synthesis of methyl farnesoate. There is no direct evidence for the production of methyl farnesoate or juvenile hormone (JH) in ticks, and no evidence that these compounds, when introduced exogenously, affect tick development and reproduction. Supplementary Fig. 19. Recent gene expansion for farnesoic acid methyltransferase/methyl transferase in the Ixodes scapularis genome showing 44 copies. Blue fonts are for the sequences found in the I. scapularis with the frequency of the EST for each predicted gene in the parenthesis and bar graph on the right column. Solid circles at the branching points are for bootstrapping supports with higher than 70% in 1000 replications of the neighbor-joining tree. Insect genes in the orthologous group are from Tribolium castaneum (Tc), Drosophila melanogaster (Dm), Aedes aegypti (Aa), Helicoverpa armigera (Ha), Bombyx mori (Bm), and Eriocheir sinensis (Es). The VectorBase accession for the predicted protein and corresponding base-pair range of each gene on the I. scapularis scaffolds are; ISCW000145, DS624614 (1302..5354); ISCW000146, DS624614 (9631..10170); ISCW000153, DS763941 (182505..186413); ISCW000579, DS947122, (6316..11994); ISCW000581, DS629339, (179176..194485), ISCW001490, DS706167, (10281..31698); ISCW002306, DS932067, (897..5521); ISCW002935, DS768854, (735905..747194); ISCW003340, DS779352, (21734..27575); ISCW003481, DS793841, (18669..25357); ISCW004808, DS674354, (11645..16314); ISCW005290, DS970697, (84452..85469); ISCW005302, DS629339, (117659..129013); ISCW005399, DS777710, (6901..10266); ISCW005831, DS887498, (197112..207263); ISCW006025, DS954326, (27895..30828); ISCW006197, DS748781, (26926..29875); ISCW006201, DS851612, (37761..41988); ISCW006304, DS930042, (10717..12534); ISCW006899, DS690206, (9184..9657); ISCW006900, DS741077, (829..13451); ISCW006924, DS872849, (1313..1855); ISCW007168, DS789606, (16620..25257); ISCW007263, DS768854, (719374..727853); ISCW007368, DS779352, (129774..133039); ISCW007369, DS967436, (35953..41027); ISCW008032, DS652581, (3712..4362); ISCW008748, DS748497, (1567..25229); ISCW010473, DS615618, (20473..34490); ISCW011169, DS751725, (281571..300251); ISCW012621, DS638221, (12578..13060); ISCW013074, DS781271, (1344..5551); ISCW013675, DS781271, (13943..14422); ISCW014084, DS751647, (5328..26009); ISCW014478, DS880071, (28950..39043); ISCW014552, DS977870, (16944..20120); ISCW015008, DS644550, (414041..414787); ISCW015523, DS928935, (5815..7014); ISCW016046, DS972004, (8558..19224); ISCW017567, DS746255, (64199..77852); ISCW018807, DS661924, (43567..48537); ISCW018808, DS735014, (408..7677); ISCW019053, DS710865, (6303..9071); ISCW019728, DS970447, (16214..18413); ISCW023392, DS802122, (55507..58567); ISCW023772, DS938188, (37911..40070); ISCW023837, DS770764, (14572..19070). Supplementary Fig. 20. Phylogenetic relationships among gustatory (GRs) and olfactory (ORs) receptors. Protein sequences from Ixodes scapularis (green), Daphnia pulex (blue), Drosophila melanogaster (orange) and Anopheles gambiae (maroon). Sugar and CO2 receptors are highlighted in black. The insect olfactory receptors (grey) include protein sequences of several species: D. melanogaster (Or), Tribolium castaneum (Tc), Anopheles gambiae (Ag), Pediculus humanus (Ph), and Acyrthosiphon pisum (Ap). Supplementary Fig. 21. Phylogenetic tree of the Ixodes scapularis Ionotropic Receptor (IR) and ionotropic glutamate receptor protein sequences (blue), alongside their Drosophila melanogaster (red) orthologs. Different receptor subfamilies of receptors are highlighted with black vertical lines. Protein sequences were aligned with MUSCLE, and the tree was built with RAxML under the WAG model of substitution with 1000 bootstrap replicates. Bootstrap values for each branch are indicated on the tree. The scale bar represents the number of substitutions per site. Supplementary Fig. 22. In silico analysis of the (a) Toll and (b) IMD pathways in the Ixodes scapularis genome. Gene identifiers were obtained from VectorBase (www.vectorbase.org) and compared to the Toll and IMD pathways in Drosophila melanogaster, Anopheles gambiae and Aedes aegypti mosquitoes. Gene identifiers from I. scapularis are boxed. Red question marks indicate genes that were not identified in the I. scapularis genome. Dagger marks represent sequences for which putative I. scapularis homologues were uncovered but cannot be categorized as precise orthologs. Asterisks indicate sequences for which putative I. scapularis homologues were uncovered but cannot be categorized at the isoform level. Supplementary Fig. 23. In silico analysis of the (a) JAK/STAT and (b) anti-viral RNAi pathways in the I. scapularis genome. Gene identifiers were obtained from VectorBase (www.vectorbase.org) and compared to the JAK/STAT and RNAi pathways in Drosophila melanogaster, Anopheles gambiae and Aedes aegypti mosquitoes. Gene identifiers from I. scapularis are boxed. Red question marks indicate genes that were not identified in the I. scapularis genome. Supplementary Fig. 24. Protein expression in early and late Anaplasma phagocytophilum infection of Ixodes scapularis ISE6 cells. The Venn diagram shows the number of proteins (in parenthesis) that are over- or under- represented in early versus late infection (*indicates significant overlaps; p<106). Supplemental Fig. 25. The Ixodes scapularis ligand-gated anion channel (KR107244) expressed in Xenopus laevis oocytes was exposed in turn to a series of neurotransmitter molecules that have been shown to activate invertebrate ligand-gated anion channels. The transmitters were tested separately at 10-4 M on oocytes (n=29, 7, 7, 6, 7, 6, 6 respectively). Only L-glutamate yielded a current. All others tested (acetylcholine (ACh), γ-amino butyric acid (GABA), dopamine, histamine, serotonin, tyramine) were without effect. Glycine, which like GABA activates ligand gated anion channels in mammalian brain was also without effect (n=7). This selectivity for L-glutamate led to the nomenclature IscaGluCl1 for subunit KR107244. Supplementary Tables Supplementary Table 1. Cumulative effect of Ixodes scapularis IscaW1 assembly intervention. Assembly Settings A B C D Input reads ~12,000,000 16,632,252 16,875,697 16,875,697 Software version CA 3.1 CA 4.0 CA 4.0 CA 4.0 Partial overlaps for trim + K-mer seed length 22 16 16 28 16 28 + seed frequency threshold default 50 50 1000 50 1000 + error threshold 6% 6% 6% 6% 6% 6% + overlap length threshold 40 40 40 300 40 300 + detect and trim chimer yes yes no no Full overlaps for unitigs + K-mer seed length 22 22 14 14 + seed frequency threshold default default 8000 8000 + initial error threshold 6% 6% 20% 20% + basecall correction yes yes no no + final error threshold 3% 3% 13% 13% Contig building + assumed genome size default default default 1 Gbp + max error, unitig join 6% 6% 20% 20% + max error, gap close 6% 6% 12% 20% Assembly Results A B C D Contigs + number of contigs 600,000 843,837 474,816 570,640 + max bases per contig 30,000 76,172 83,974 117,687 + contig N50 bases 1,900 1,943 3,116 2,942 + mean bases per contig n/a 1,997 2,554 2,433 + mean coverage 2.0 2.3 3.4 3.5 + reads incorporated 30% 35% 37% 44% + total contig bases n/a 1,684,909,012 1,212,614,075 1,388,475,690 Scaffolds + number of scaffolds 500,000 680,216 327, 135 369, 495 + max span per scaffold 250,000 645,492 3,360,897 3,699,225 + scaffold N50 span 2,200 2,535 22,441 51,551 + mean span per scaffold n/a 3,209 4,606 4,774 + total scaffold span 2,150,000,000 2,182, 541,146 1,506,734,076 1,763,920,678 Four assemblies of Ixodes scapularis. Columns A through D summarize four runs of the Celera Assembler software. Assembly Settings. Partial overlaps are local alignments between read pairs. Celera Assembler trimmed terminal basecalls of reads based on drop off patterns in the partial overlap collection. Parameter changes during assemblies B and C were designed to enlarge the collection. Assemblies C and D used the union of two collections. Full overlaps are pair-wise alignments that fully cover at least two of the four read ends; they capture dovetail and containment relations. Parameter changes during assemblies C and D were designed to enlarge the collection. Parameter changes during assemblies C and D were designed to reduce sensitivity to high-coverage unitigs (genome size), consensus differences in multiple sequence alignments (unitig join), and basecall differences between trimmed sequences at contig ends (gap close). Assembly Results. In the Celera Assembler output, contigs and scaffolds are redundant organizations of the same consensus sequence. Every contig belongs to one scaffold and every scaffold spans one or more contigs. Contigs have positive read coverage at every base. Scaffolds span gaps between contigs where gap size is derived from spanning mate constraints. Scaffolds also span repetitive regions where a unitig consensus is placed as surrogate for read coverage. Contig N50 is the number of bases of the smallest contig in the minimal set that covers 50% of the assembly’s total contig bases. Scaffold N50 is the span smallest scaffold in the minimal set that covers 50% of the assembly’s total scaffold span. Mean coverage is the sum of bases after trimming in reads incorporated into contigs divided by total contig bases. Supplementary Table 2. Size and distribution of DNA on Ixodes scapularis IscaW1 scaffolds. Scaffold Length No. Scaffolds Total No. Basesa % Genome in Scaffolds 1Mb – 4 Mb 51 84,551,570 3.6% 100 kb – 999 kb 2,914 743,132,618 32.1% 10 kb – 99 kb 14,397 390,238,447 16.8% < 10 kb 352,130 545,998,043 23.6% Total 369,492 1,763,920,678 76% Calculations are based on the genome size estimate of 2.31 Gb a Based on total scaffold span for column “D” in Supplementary Table 1. Supplementary Table 3. Ixodes scapularis genome annotation IscaW1 statistics Transcription units - genes Ixodes scapularis Aedes aegypti (AaegL1.3) Anopheles gambiae (AgamP3.7) Drosophila melanogaster (FB2012_04) Daphnia pulex (Ensembl Genome 71) Tetranychus urticae (Ensembl Genomes 72) Total number of protein coding genes 20,486 15,998 12,810 13,937 30,894 18,224 Mean gene length (bp) 10,589 15,456 6,383 6,492 2,116 2,733 Median gene length (bp) 4,259 5,895 2,076 2,088 1,279 1,549 Shortest gene (bp) 95 105 111 117 150 99 Longest gene (bp) 242,297 428,674 365,622 395,988 114,502 104,962 Exons Total number of exons 89,663 64,752 56,398 74,024 144,872 69,647 Number of mono-exonic genes 5,707 1,874 1,187 2,170 5,149 2,213 Max. no. exons/gene 81 41 67 82 83 55 Median exon length (bp) 219 231 232 246 154 179 Introns Total number of introns 69,163 52,370 51,024 133,158 113,998 16,041 Percentage of genes with introns 72.10% 88.3% 90.8% 84.4% 83.3% 88% Mean intron length (bp) 2,284 4,789 1,566 1,568 285 456 Median intron length (bp) 1, 599 145 96 103 76 96 Shortest intron (bp) 15 1 1 1 0 (!) 1 Longest intron (bp) 54, 366 329,294 249,417 141,627 48,487 59,291 Coding sequences (CDS) Mean CDS length (bp) 855 1,363 1,616 1,977 976 1,074 Median CDS length (bp) 594 1,053 11,191 1,404 702 807 Shortest CDS (bp) 95 81 78 20 150 63 Longest CDS (bp) 15,248 33,987 47,535 68,850 23,331 54,762 RNAs Non coding RNAs 4,439 1,279 612 474 3,567 n/a tRNAs 4,402 962 450 314 3,559 n/a miRNAs 51 84 121 n/a 7 n/a rRNAs 8 233 41 160 1 n/a Miscellaneous Statistics Gene frequency (genes/kb) 1/70 1/82 1/22 1/12 1/6 1/5 Percentage of coding region in genome 6% - - - - - Av. Intergenic region (bp) a 80, 410 - - - - - Av. Intergenic region (bp) b 57, 141 - - - - - Intergenic regions GC content 32% - - - - - Coding regions GC content 56% - - - - - Total GC content NA 38.2 40.9 42.5 - NA, not available a ten longest scaffolds b global Supplementary Table 4. Analysis of Ixodes scapularis Bacterial Artifical Chromosomes (BACs) showing assembly completeness and mapping to IscaW1 scaffolds. BAC Name GenBank Accession BAC Length (bp) Sequencing Center Assembly Status IscaW1 Scaffold Hits a GenBank IscaW1 Scaffold ID ISG1-05A01 AC192414 117,688 Broad 1 C 2 DS776359 DS810098 ISG1-33A01 AC192415 122,081 Broad 2 OP 3 DS818409 DS825617 DS768807 ISG1-36A01 AC192416 106,082 Broad 2 OP 1 DS694416 ISG1-40A01 AC192417 102,815 Broad 3 UP 4 DS840034 DS872355 DS892014 DS682990 ISG1-41A01 AC192418 114,701 Broad 3 UP 1 DS907939 ISG1-43A01 AC192419 113,880 Broad 2 OP multiple N/A ISG1-45A01 AC192420 146,997 Broad 19 UP multiple N/A ISG1-49A01 AC192421 137,442 Broad 7 UP 2 DS858616 DS746366 ISG1-51A01 AC192422 135,954 Broad 2 OP 1 DS752087 ISG1-53A01 AC192423 109,798 Broad 2 OP multiple N/A ISG1-55A01 AC192424 145,462 Broad 5 UP 1 DS732299 ISG1-60A01 AC192425 145,957 Broad 6 OP multiple N/A ISG1-64A01 AC192426 117,608 Broad 4 UP 1 DS868627 ISG1-66A01 AC192427 98,661 Broad 1 C 1 DS911446 ISG1-67A01 AC192428 109,864 Broad 3 OP multiple N/A ISG1-68A01 AC192429 142,474 Broad 3 UP multiple N/A ISG1-48A01 AC192742 133,074 Broad 1 C 1 DS780529 ISG1-54A01 AC192743 130,937 Broad 8 UP multiple N/A ISG1-61A01 AC192744 115,169 Broad 2 OP multiple N/A ISG1-02A01 AC200531 77,162 Broad 1 C multiple N/A ISG1-01F14 AC205630 95,257 JCVI 1 C multiple N/A ISG1-01P02 AC205631 108,728 JCVI 2 OP multiple N/A ISG1-03K02 AC205632 26,509 JCVI 1 C multiple N/A ISG1-03P02 AC205633 97,928 JCVI 4 OP multiple N/A ISG1-06P02 AC205634 112,417 JCVI 1 C multiple N/A ISG1-11P02 AC205635 104,824 JCVI 1 C 1 DS800715 ISG1-12P02 AC205636 106,974 JCVI 6 OP 4 DS688082 DS708137 DS966567 DS826915 ISG1-14C07 AC205637 132,125 JCVI 3 OP multiple N/A ISG1-15P02 AC205638 100,378 JCVI 1 C multiple N/A ISG1-16P02 AC205639 92,783 JCVI 4 OP multiple N/A ISG1-22P02 AC205640 109,965 JCVI 4 OP multiple N/A ISG1-24P02 AC205641 179,341 JCVI 1 C multiple N/A ISG1-27P02 AC205642 110,473 JCVI 1 C 3 DS859588 DS928213 DS859588 ISG1-31P02 AC205643 128,247 JCVI 1 C 1 DS891538 ISG1-37P02 AC205644 110,110 JCVI 2 OP multiple N/A ISG1-41M08 AC205645 120,605 JCVI 2 OP 2 DS712833 Broad, the Broad Institute of MIT/Harvard; JCVI, J. Craig Venter Institute; C, complete assembly of BAC clone: BAC assembly sequence is complete and ungapped; OP, ordered pieces: the BAC assembly is incomplete but the order of contigs comprising the BAC is known; UP, unordered pieces: the BAC assembly is incomplete and the order of the pieces cannot be deduced basded on read mate pair information; a numeric value indicating number of IscaW1 scaffolds that align to the assembled BAC clone; multiple, 10 or more IscaW1 scaffolds align to the sequence of the assembled BAC clone. DS712833 ISG1-42P02 AC205646 122,242 JCVI 1 C 1 DS840967 ISG1-43E15 AC205647 115,710 JCVI 1 C multiple N/A ISG1-44P02 AC205648 126,904 JCVI 3 OP multiple N/A ISG1-47P02 AC205649 112,049 JCVI 2 OP multiple N/A ISG1-56P02 AC205650 107,316 JCVI 1 C 1 DS636787 ISG1-58P02 AC205651 172,210 JCVI 2 OP 1 DS879425 ISG1-62P02 AC205652 50,437 JCVI 1 C multiple N/A ISG1-63P02 AC205653 108,041 JCVI 1 C 3 DS976271 DS897480 DS981194 ISG1-69P02 AC205654 14,567 JCVI 1 C multiple N/A Supplementary Table 5. Analysis of gene content of Ixodes scapularis BAC clones. The IscaW1 predicted protein sequences were queried against the sequence of assembled BAC clones using BLASTX. BAC Clone GenBank Accession BAC length (bp) Genbank Protein Locus Tag IscaW1 Gene length (bp) Hit coordinates on BAC % ID to annotated IscaW1 protein Gene coverage (%BAC/IscaW1) Protein name 5’ end 3’ end AC205647 115,710 ISCW001627 999 71,697 72,691 96.2 100 hypothetical protein AC205650 107,316 ISCW001662 1,595 40,314 41,908 100 100 voltage-gated potassium channel AC205637 132,125 ISCW005308 1,139 1,261 2,400 95.18 99.82 conserved hypothetical protein AC192428 109,864 ISCW005551 813 51,858 52,672 97.06 100 hypothetical protein AC205642 110,473 ISCW007049 903 11,042 11,941 95.57 100 hypothetical protein AC205646 122,242 ISCW007900 912 12,862 13,716 97.19 93.53 conserved hypothetical protein AC192414 117,688 ISCW008378 1,017 104,265 105,120 96.85 84.17 hypothetical protein AC205636 106,974 ISCW009194 1,776 104,329 106,149 95.28 100 leucine-rich transmembrane protein, putative AC205645 120,605 ISCW009445 1,086 36,434 37,293 98.84 79.01 hypothetical protein AC205637 132,125 ISCW011925 1,182 99,621 100,799 97.88 99.83 hypothetical protein AC205637 132,125 ISCW011924 909 101,454 102,362 97.14 100 hypothetical protein AC192418 114,701 ISCW012420 1,188 101,002 102,058 95.84 87.96 polyprotein of retroviral origin AC205636 106,974 ISCW013209 1,974 51,710 53,682 97.63 100 hypothetical protein AC205648 126,904 ISCW014746 1,401 75,055 76,459 96.59 99.86 hypothetical protein AC205653 108,041 ISCW015369 753 94,678 95,428 98.93 99.73 hypothetical protein AC192428 109,864 ISCW017315 1,113 48,937 49,821 97.3 79.78 hypothetical protein AC192418 114,701 ISCW018410 1,799 76,283 78,081 98.78 100 conserved hypothetical protein AC192422 135,954 ISCW019007 1,464 88,949 90,400 96.6 99.8 transmembrane protein C9orf46 AC192422 135,954 ISCW019010 1,083 16,384 17,471 99.17 100 conserved hypothetical protein AC205645 120,605 ISCW019863 2,507 86,223 88,736 96.07 100 zinc finger protein, putative AC205645 120,605 ISCW019864 4,307 89,682 93,981 95.79 99.72 zinc finger protein, putative AC205635 104,824 ISCW019867 6,487 80,684 87,155 98.68 100 zinc finger protein, putative AC205635 104,824 ISCW019869 1,182 52,935 54,101 97.29 100 zinc finger protein, putative AC205635 104,824 ISCW019871 1,353 4,616 5,971 99.41 100 carbon-nitrogen hydrolase AC205646 122,242 ISCW020015 945 111,615 112,559 100 100 hypothetical protein AC192421 137,442 ISCW021499 843 18,199 19,056 96.5 99.88 hypothetical protein AC192421 137,442 ISCW021498 897 46,540 47,435 98.11 99.55 hypothetical protein AC205640 109,965 ISCW024821 1,090 6,451 7,539 99.45 100 hypothetical protein Supplementary Table 6. Putative microRNA genes identified in the Ixodes scapularis genome. MicroRNA gene predictions were consolidated from miRBase160, miROrtho161, and VectorBase162, resulting in a conservative set of 45 miRNAs. Family: assigned based on similarity to miRBase miRNAs. miRBase-ID, miROrtho-ID, VectorBase-ID: resource specific gene identifiers. miRBase-Family: family identifier, if predicted. Chromosome, Start, End, Strand: location in the I. scapularis genome or trace reads. Family miRBase- ID miROrtho- ID VectorBase-ID miRBase-Family Scaffold Start (bp) End (bp) Strand bantam MI0012259 616211 NA MIPF0000153 DS612599 38772 38872 - mir-133 MI0012266 NA NA MIPF0000029 DS613658 228744 228844 - mir-7 MI0012282 615892 NA MIPF0000022 DS629750 8358 8437 - mir-263 MI0012272 NA ISCW000811 MIPF0000122 DS633978 93542 93641 + mir-263 NA 616209 ISCW000812 NA DS633978 112822 112905 + mir-96 MI0012288 NA ISCW000813 MIPF0000072 DS633978 113211 113315 + mir-279 MI0012274 615761 ISCW000516 MIPF0000184 DS634011 38506 38597 + mir-153 MI0012268 617851 NA MIPF0000050 DS642248 1296642 1296742 - mir-219 MI0012270 NA ISCW002511 MIPF0000044 DS658596 21107 21207 - mir-315 MI0012278 NA NA MIPF0000141 DS711462 57333 57433 + mir-8 MI0012286 615572 ISCW005313 MIPF0000019 DS755496 12152 12245 - mir-2001 MI0010250 616271 NA none DS758004 38911 38988 - mir-2 MI0012276 NA NA MIPF0000049 DS799611 45157 45257 - mir-2 MI0012277 616921 NA MIPF0000049 DS799611 45547 45647 - mir-71 MI0012283 616923 NA MIPF0000278 DS799611 45689 45789 - mir-184 MI0012269 NA NA MIPF0000059 DS803854 570 670 - mir-1 MI0012261 NA ISCW019387 MIPF0000038 DS811420 416289 416380 + mir-1905 NA 616494 NA NA DS833022 58235 58298 - mir-124 MI0012265 NA ISCW009604 MIPF0000021 DS840700 85144 85244 + none MI0015941 NA NA none DS841188 7191 7293 + mir-137 MI0012267 617785 NA MIPF0000106 DS847994 158277 158377 - mir-276 MI0016443 616110 NA none DS848078 34717 34803 - mir-335 NA 618522 NA NA DS850031 1991 2088 + mir-1993 MI0015940 NA NA none DS862055 102 182 + mir-1175 NA 616890 NA NA DS874548 51760 51844 - mir-750 MI0012284 616924 NA MIPF0000796 DS874548 52964 53064 - mir-9 MI0012285 NA NA MIPF0000014 DS885551 436490 436590 + mir-317 MI0012279 617989 NA MIPF0000144 DS891538 57423 57523 - mir-iab-4 MI0016445 617926 NA MIPF0000151 DS891538 738905 739003 - mir-iab-4 NA 617910 NA NA DS891538 738924 738992 + mir-10 MI0012262 NA NA MIPF0000033 DS891538 2780812 2780883 + mir-993 MI0012289 617990 NA MIPF0000698 DS891538 3285820 3285911 - mir-67 MI0012281 617852 NA MIPF0000293 DS911299 1700291 1700391 - mir-87 MI0012287 NA NA MIPF0000152 DS929532 41471 41571 - mir-375 MI0012280 NA NA MIPF0000114 DS929532 41471 41571 - mir-87 NA 617584 NA NA DS929532 41890 41991 - mir-12 MI0012264 NA NA MIPF0000181 DS942119 45739 45839 - mir-305 MI0016444 616960 NA MIPF0000158 DS945001 228258 228352 - mir-275 MI0012273 617124 NA MIPF0000187 DS945001 243239 243339 - mir-190 NA 616305 NA NA DS969850 171528 171624 + mir-125 NA NA ISCW023847 NA DS978597 217027 217099 - mir-99 MI0012263 NA ISCW023848 MIPF0000025 DS978597 252465 252565 - let-7 MI0012260 NA NA MIPF0000002 gnl|ti|1145246679 601 700 + mir-29 MI0012275 NA NA MIPF0000009 gnl|ti|1308393763 736 831 + mir-252 MI0012271 NA NA MIPF0000285 gnl|ti|1711070620 757 857 + Supplementary Table 7. Proportions of shared intron positions across 12 animal species. Examining conservation of intron positions between ISCAP, DPULE and either the five insects (PHUMA, NVITR, TCAST, AGAMB, DMELA) or the five non-arthropods (NVECT, HSAPI, MMUSC, GGALL, DRERI) reveals that greater than 10 times more intron positions are shared exclusively between at least one of the outgroup species (Cnidaria or Vertebrata) and ISCAP, compared to DPULE (13.80% compared to 1.08%). Conversely, DPULE shares about 4 times more intron positions exclusively with insects (2.34% compared to 0.58%). The percentages shown in Fig. B are the mean values from the numbers of shared or unique positions out of the total number of intron positions (4,621 SSC and 13,459 RSC) as detailed in the table. Abbreviations: NVECT, Nematostella vectensis; HSAPI, Homo sapiens; MMUSC, Mus musculus; GGALL, Gallus gallus; DRERI, Danio rerio; ISCAP, Ixodes scapularis; DPULE, Daphnia pulex; PHUMA, Pediculus humanus; NVITR, Nasonia vitripennis; TCAST, Tribolium castaneum; AGAMB, Anopheles gambiae; DMELA, Drosophila melanogaster. Intron Positions SSC RSC SSC% RSC% Mean% OUT ONLY 656 1776 14.20 13.20 13.70 INS ONLY 128 403 2.77 2.99 2.88 OUT-ISCAP ONLY 659 1795 14.26 13.34 13.80 OUT-DPULE ONLY 47 155 1.02 1.15 1.08 INS-ISCAP ONLY 24 85 0.52 0.63 0.58 INS-DPULE ONLY 108 314 2.34 2.33 2.34 OUT-INS-ISCAP ONLY 330 1116 7.14 8.29 7.72 OUT-INS-DPULE ONLY 180 456 3.90 3.39 3.64 OUT-ISCAP-DPULE ONLY 68 180 1.47 1.34 1.40 INS-ISCAP-DPULE ONLY 27 52 0.58 0.39 0.49 ISCAP-DPULE ONLY 12 23 0.26 0.17 0.22 OUT-INS ONLY 239 646 5.17 4.80 4.99 OUT-INS-ISCAP-DPULE 432 1169 9.35 8.69 9.02 NVECT ONLY 476 1382 10.30 10.27 10.28 HSAPI ONLY 3 12 0.06 0.09 0.08 MMUSC ONLY 3 8 0.06 0.06 0.06 GGALL ONLY 37 124 0.80 0.92 0.86 DRERI ONLY 40 95 0.87 0.71 0.79 ISCAP ONLY 154 501 3.33 3.72 3.53 DPULE ONLY 502 1579 10.86 11.73 11.30 PHUMA ONLY 138 459 2.99 3.41 3.20 NVITR ONLY 136 431 2.94 3.20 3.07 TCAST ONLY 87 302 1.88 2.24 2.06 AGAMB ONLY 48 164 1.04 1.22 1.13 DMELA ONLY 87 232 1.88 1.72 1.80 Totals 4621 13459 100 100 100 OUT: at least one of 5 outgroup species, NVECT, HSAPI, MMUSC, GGALL, DRERI. INS: at least one of 5 insect species, PHUMA, NVITR, TCAST, AGAMB, DMELA. SSC: strict single-copy; RSC: relaxed single-copy. Supplementary Table 8. Proportions of shared Ixodes scapularis intron positions. Examining pairwise conservation of intron positions between ISCAP and each of the other eleven species shows the greatest sharing with the non-arthropods (NVECT, HSAPI, MMUSC, GGALL, DRERI): about 3 times more than with AGAMB and DMELA, and about 1.5-1.8 times more than with DPULE, PHUMA, NVITR, and TCAST. Abbreviations: NVECT, Nematostella vectensis; HSAPI, Homo sapiens; MMUSC, Mus musculus; GGALL, Gallus gallus; DRERI, Danio rerio; ISCAP, Ixodes scapularis; DPULE, Daphnia pulex; PHUMA, Pediculus humanus; NVITR, Nasonia vitripennis; TCAST, Tribolium castaneum; AGAMB, Anopheles gambiae; DMELA, Drosophila melanogaster. ISCAP ALL SSC % ALL RSC % SHARED SSC % SHARED RSC % NVECT 29.86 30.07 35.01 35.67 HSAPI 31.84 32.3 33.13 33.82 MMUSC 31.83 32.03 33.12 33.54 GGALL 31.71 32.08 33.28 33.92 DRERI 31.84 32.18 33.43 33.94 DPULE 17.49 16.09 22.22 21.04 PHUMA 20.89 21.12 23.3 23.92 NVITR 19.5 19.92 21.79 22.57 TCAST 17.02 16.62 18.85 18.72 AGAMB 10.76 11.09 11.85 12.39 DMELA 10.31 10.85 11.57 12.25 SSC: strict single-copy, RSC: relaxed single-copy. ALL: ISCAP-OTHER Shared / ISCAP-OTHER Total Intron Positions. SHARED: ISCAP-OTHER Shared / ISCAP-OTHER Total Non-Unique Intron Positions. Supplementary Table 9. Intron presence, gain, and loss estimates across the 12 animal species phylogeny. Intron presence, gain, and loss estimates across the phylogeny for the strict (SSC) and relaxed (RSC) sets of orthologs using Dollo Parsimony (DP) and Posterior Probability (PP) methods of the MALIN suite for maximum likelihood analysis of intron evolution in eukaryotes33. The normalized numbers and the species phylogeny with all named nodes are presented in Supplementary Fig. 9. Abbreviations: NVECT, Nematostella vectensis; HSAPI, Homo sapiens; MMUSC, Mus musculus; GGALL, Gallus gallus; DRERI, Danio rerio; ISCAP, Ixodes scapularis; DPULE, Daphnia pulex; PHUMA, Pediculus humanus; NVITR, Nasonia vitripennis; TCAST, Tribolium castaneum; AGAMB, Anopheles gambiae; DMELA, Drosophila melanogaster. SSC30: 4621 sites RSC30: 13459 sites DP PP DP PP Branch/Leaf present gain loss present gain loss present gain loss present gain loss DMELA 506 87 165 506 94 242 1492 232 447 1492 236 743 Diptera 584 38 307 654 99 317 1707 125 834 2000 352 826 AGAMB 487 48 145 487 52 219 1420 164 451 1420 133 713 Diptera-Coleoptera 853 12 359 872 25 357 2416 52 1052 2473 110 1107 TCAST 768 87 172 768 105 209 2223 302 495 2223 362 612 Holometabola 1200 16 218 1203 0 175 3416 45 648 3470 0 486 NVITR 1053 136 283 1053 187 337 3011 431 836 3011 564 1023 Insecta 1402 62 127 1378 47 11 4019 181 358 3957 93 0 PHUMA 1118 138 422 1118 170 430 3284 459 1194 3284 562 1235 Pancrustacea 1467 108 659 1342 122 1051 4196 314 1795 3864 421 2727 DPULE 1376 502 593 1376 614 580 3928 1579 1847 3928 1911 1847 Arthropoda 2018 63 422 2271 86 302 5677 160 1043 6170 128 806 ISCAP 1706 154 466 1706 148 713 4921 501 1257 4921 524 1773 Coelomata 2377 279 0 2487 398 14 6560 866 0 6848 1205 112 DRERI 2392 40 20 2392 41 23 6581 95 65 6581 100 66 Vertebrata 2372 231 236 2374 183 295 6551 716 725 6547 593 894 GGALL 2334 37 44 2334 37 44 6552 124 82 6552 129 80 Tetrapoda 2341 3 34 2341 1 34 6510 15 56 6504 9 52 MMUSC 2337 3 4 2337 3 4 6380 8 112 6380 10 113 Mammalia 2338 0 3 2338 0 3 6484 2 28 6483 2 23 HSAPI 2336 3 5 2336 3 5 6454 12 42 6454 12 41 Metazoa 2098 NA NA 2103 NA NA 5694 NA NA 5756 NA NA NVECT 2574 476 0 2574 471 0 7076 1382 0 7076 1320 0 Supplementary Table 10. Comparisons of intron length distributions across 12 animal species. Comparison of intron lengths among the 12 species for the Strict Single-Copy (SSC) and Relaxed Single-Copy (RSC) sets of orthologs. Intron counts, their median and mean lengths, and the p-values from Wilcoxon tests that compare the length distributions are presented for 1. all informative introns, 2. informative introns found in ISCAP and DPULE and at least one non-arthropod and at least one insect, 3. informative introns shared between ISCAP and each of the other species. The length distributions are presented as boxplots in Supplementary Fig. 7 and the species for which the shared site data are presented in Fig. 3C (main text) are indicated with an asterisk (*). Abbreviations: P-Wilcox, paired Wilcoxon test; NVECT, Nematostella vectensis; HSAPI, Homo sapiens; MMUSC, Mus musculus; GGALL, Gallus gallus; DRERI, Danio rerio; ISCAP, Ixodes scapularis; DPULE, Daphnia pulex; PHUMA, Pediculus humanus; NVITR, Nasonia vitripennis; TCAST, Tribolium castaneum; AGAMB, Anopheles gambiae; DMELA, Drosophila melanogaster. SSC 1. All: 4621 sites 2. Shared: 432 sites 3. ISCAP-shared Count Median Mean Wilcox Count Median Mean Wilcox Count Median Mean P-Wilcox NVECT 2574 404.0 635.0 <2.2e-16 371 421.0 684.8 <2.2e-16 1278 401.0 628.7 <2.20e-16 HSAPI 2336 1386.0 2998.1 6.60e-05 399 1474.0 3575.0 8.02e-03 1287 1385.0 3169.0 1.35e-05 MMUSC 2337 1128.0 2111.0 9.22e-02 401 1288.0 2550.0 6.14e-01 1287 1191.0 2257.0 6.23e-01 GGALL 2334 665.5 1474.7 <2.2e-16 398 703.5 1473.0 1.43e-07 1281 685.0 1364.0 <2.20e-16 DRERI 2392 666.5 1548.1 <2.2e-16 407 861.0 1819.6 3.88e-05 1305 713.0 1589.0 1.98e-13 ISCAP 1706 1223.5 2053.3 NA 432 1194.5 2187.7 NA 1552 1205.5 2043.6 NA DPULE 1376 66.0 91.5 <2.2e-16 432 66.0 99.7 <2.2e-16 539 66.0 94.9 <2.20e-16 PHUMA 1118 87.0 143.3 <2.2e-16 313 90.0 160.3 <2.2e-16 590 88.0 141.3 <2.20e-16 NVITR 1053 81.0 357.8 <2.2e-16 304 81.0 348.8 <2.2e-16 538 81.0 268.3 <2.20e-16 TCAST 768 51.0 435.6 <2.2e-16 246 50.0 436.2 <2.2e-16 421 50.0 357.1 <2.20e-16 AGAMB 487 78.0 539.7 <2.2e-16 146 77.0 557.4 <2.2e-16 236 78.0 534.7 <2.20e-16 DMELA 506 62.0 351.3 <2.2e-16 143 62.0 183.4 <2.2e-16 228 62.0 408.2 <2.20e-16 RSC 1. All: 13459 sites 2. Shared: 1169 sites 3. ISCAP-shared Count Median Mean Wilcox Count Median Mean Wilcox Count Median Mean P-Wilcox NVECT 7076 407.0 645.9 <2.2e-16 976 426.5 662.6 <2.2e-16 3608 408.0 648.8 <2.20e-16 HSAPI* 6454 1483.0 3687.2 <2.2e-16 1060 1745.5 4723.6 7.93e-12 3674 1552.0 4042.0 <2.20e-16 MMUSC* 6380 1224.5 2743.9 3.26e-01 1050 1447.0 3751.0 3.68e-04 3620 1288.0 3052.5 1.98e-02 GGALL 6552 693.5 1700.0 <2.2e-16 1070 761.0 2217.1 2.10e-11 3680 727.0 1815.0 <2.20e-16 DRERI 6581 728.0 1787.0 <2.2e-16 1084 935.0 2204.0 1.81e-07 3701 785.0 1917.0 <2.20e-16 ISCAP* 4921 1213.0 2034.0 NA 1169 1204.0 2125.0 NA 4420 1188.0 1999.0 NA DPULE* 3928 66.0 86.9 <2.2e-16 1169 67.0 89.2 <2.2e-16 1424 67.0 86.9 <2.20e-16 PHUMA* 3284 88.0 155.8 <2.2e-16 861 91.0 188.4 <2.2e-16 1733 89.0 163.3 <2.20e-16 NVITR* 3011 82.0 565.1 <2.2e-16 816 82.0 436.0 <2.2e-16 1580 82.0 419.2 <2.20e-16 TCAST 2223 51.0 459.9 <2.2e-16 628 50.0 374.4 <2.2e-16 1187 50.0 368.4 <2.20e-16 AGAMB 1420 80.5 473.8 <2.2e-16 408 81.0 628.9 <2.2e-16 703 80.0 574.6 <2.20e-16 DMELA* 1492 63.0 256.9 <2.2e-16 383 64.0 305.3 <2.2e-16 696 63.0 328.5 <2.20e-16 Supplementary Table 11. Summary of gene group counts using OrthoMCL clustering of reciprocal best hit BLASTP. Species oGene nGroup UDup Orth1 OrDup OrGrp OrMis1 No. in Chelicerata Ixodes scapularis 11817 8594 2079 7239 2499 7945 110 Tetranychus urticae 11194 6685 4000 5227 1967 5937 147 Dermacentor variabilis 41142 11157 31914 4076 5152 4865 1189 No. in Crustacea Daphnia magna 38049 20334 20313 9092 8644 12354 5 Daphnia pulex 27825 14456 10784 10410 6631 11866 10 Pandalus latirostris 28999 13397 19164 5330 4505 7017 122 No. in Insecta Acrythosiphon pisum 24954 9724 8848 6778 9328 8068 43 Drosophila melanogaster 11523 8449 2519 6925 2079 7627 38 Schistocerca gregaria 26797 14280 14667 6826 5304 8705 15 Tribolium castaneum 12523 8919 2119 7584 2820 8429 29 Nasonia vitripennis 18662 9605 7544 7480 3638 8259 23 No. in Vertebrate Outgroup Species Homo sapiens 18820 11829 2310 8282 8228 11089 61 Danio rerio 19916 11777 3130 8139 8647 11171 84 oGene = number of genes with reciprocal best hits used by orthomcl. nGroup = number of gene family groups (2+genes), orthology + species-unique. OrGrp = count of ortho groups (nGroup = OrGrp + unique paralog groups). UDup = species-unique duplicated paralog genes. Orth1 = count of single ortho gene. OrDup = count of duplicated ortho gene. OrMis1 = groups missing gene all others have (ignoring human) Data sources: Chelicerata: Ixodes scapularis 2011, https://www.vectorbase.org/; Tetranychus urticae, http://www.nature.com/nature/journal/v479/n7374/pdf/nature10640.pdf; Dermacentor variabilis, http://www.ncbi.nlm.nih.gov/pubmed/20060044; Crustacea: Daphnia pulex 2010, http://arthropods.eugenes.org/EvidentialGene/daphnia/daphnia_genes2010/; Daphnia magna 2011, pre-release gene set; Pandalus latirostris, http://www.ncbi.nlm.nih.gov/pubmed/22016807; Insecta: Acrythosiphon pisum 2011, http://arthropods.eugenes.org/EvidentialGene/pea_aphid2/genes- bestof3/; Drosophila melanogaster, NCBI RefSeq 2011; Locusta migratoria http://www.ncbi.nlm.nih.gov/pubmed/21209894 Tribolium casteneum, UniProt 2011; Nasonia vitripennis 2012, http://arthropods.eugenes.org/EvidentialGene/nasonia/; Vertebrates: Homo sapiens, NCBI RefSeq 2011; Danio rerio, NCBI RefSeq 2011 Supplementary Table 12. Summary of tandem repeats identified from an Ixodes scapularis small insert genomic DNA library and FISH-based physical mapping to ISE18 cell line chromosomes. Clone ID Repeat Family Repeat Length(s) (bp) Copy Number(s) in End-sequence Hybridization Intensity Hybridization Description A-02 ISR-2 95 12.8 NC NC A-03 - 21, 26, 49 5.7, 13.8, 1.9 NS NS A-07 ISR-3 376 2.5 S S A-12 - 14, 48 2.1, 2 NS NS A-17 - 118 1.9 M S/D A-22 - None (control) NA NS NS B-01 - 35, 70 3.2,2.8 S D B-08 ISR-2a 95 17.8 S S B-11 - 4, 4, 12 40.3, 22, 12 W D B-13 ISR-2c 97 15.9 S S B-20 - 11, 25, 25, 39 2.4, 3.2, 9.1, 4.2 S D B-22 - None (control) NA NS NS B-24 ISR-2b 96 10.5 S S C-02 - 41, 83 7.4, 3.7 NS NS C-07 ISR-2c 97 13.3 S S C-12 - 63 12 NS NS C-13 - 26,31 2,2.6 M D C-20 ISR-2a 95 13.1 NC NC D-02 ISR-2c 97 13.8 NC NC D-03 - 2, 32 58.5, 2.3 W D D-12 - 98 2 W D D-19 ISR-3 386 2.1 NC NC D-23 ISR-2b 96 17.4 S S E-01 ISR-2a 95 14.4 NC NC E-09 ISR-2a 95 12.7 NC NC E-18 ISR-2d 99 12.9 S S E-19 ISR-2a 95 3.7 NC NC E-20 - 2 54.5 W D E-21 - 196 9.1 M S/D E-23 - 36 5.1 W D E-24 ISR-2d 99 12.3 S S F-11 - 16, 33 2.1, 2.1 NS NS F-12 - 2, 46 30, 5.3 W D G-04 ISR-2d 99 13.8 S S G-14 ISR-2a 95 12.8 NC NC G-17 - 37, 14 2.6, 3 W D G-20 ISR-3 385 2.9 S S H-16 ISR-1 90, 179, 446 11.6, 5.8, 2 M S H-18 - 44 3.4 NS NS H-19 - 16, 243 2.1, 2.7 M D H-21 ISR-2d 99 13.6 S S H-22 ISR-2a 95 15.8 NC NC H-24 - 15, 17, 17, 44, 59 9.9, 2.6, 2.4, 3.2, 2.5 W D I-01 - 40, 41, 41, 81 2.5, 4.5, 3.6 1.9 M D I-06 ISR-2a 95 12.1 NC NC I-22 ISR-2a 95 10.6 NC NC I-24 ISR-2a 95 17 S S J-02 - 14, 40 7.9, 2 NS NS J-08 - 22, 42 2.7,2 NS NS J-15 - 77 2 W D K-01 ISR-2a 95 11 NC NC K-02 ISR-2a 95, 284 6.1, 2 NC NC K-05 ISR-2b 96 18.5 S S K-13 - 2, 40, 32, 2 31.5, 1.9, 2.5 M D L-01 - 18 10.4 NS NS L-10 ISR-2a 95 17.1 S S L-23 - 13, 17, 29 1.9, 9.5, 2 NS NS M-04 ISR-2a 95 16.7 S S M-10 - 135 8.2 W D M-16 ISR-2c 97 12.9 NC NC M-17 ISR-2c 97 12.8 NC NC M-19 ISR-2a 95 10.5 NC NC M-21 ISR-2a 95 4.7 NC NC M-23 - 2, 21 49.5, 2.4 M D N-01 - 71 4.5 M D N-07 ISR-2a 95 13.5 NC NC N-11 ISR-2c 97 14.9 NC NC N-17 - 6 16.7 M D N-19 ISR-2a 95 15.3 NC NC O-03 - 207, 413 8.4, 4.2 S S/D O-10 ISR-2a 95 15.2 NC NC O-14 ISR-2d 99 10.9 S S O-15 - 11, 32, 32 2.8, 3.8, 3.6 NS NS O-21 - 6, 17, 18, 78 8, 3.4, 13.8, 2 S D O-24 - 155 3.7 W D P-03 - 27, 53, 83 12.4, 5.9 2.5 W D P-07 - 21 5 NS NS P-14 ISR-2c 97 16.1 NC NC Hybridization intensity: S=strong; M=moderate; W=weak; NS=no signal, NC=not conducted. Hybridization descriptions: S=specific; D=dispersed; NS=no signal; NC=not conducted. The “Repeat Family” column indicates which of the tandem-repeat containing clones that were classified into ISR-1-3 41 or that contained different tandem repeats that remain unclassified (-). Supplementary Table 13. Summary of transposable elements identified in the Ixodes scapularis genome. TE name Elements per family Copy Number Base pairs % Genome Class I LTR retrotransposons 41 29462 11383395 0.64 Gypsy 37 28997 11189309 0.63 Pao-Bel 4 465 194086 0.01 Non-LTR retrotransposons 530 606602 118212063 6.70 CR1 128 133579 26561455 1.50 I 43 49040 9402964 0.53 Jockey 2 6 3896 0.00 L1 171 201621 36843465 2.09 L2 65 57882 11639922 0.66 R1 7 430 61781 0.00 R4 2 1924 582360 0.03 Other Non-LTR 112 162120 33116220 1.88 Penelope Penelope 132 94326 19113444 1.08 Class II DNA transposons 254 293281 54005181 3.06 hAT 52 32713 7362901 0.42 Merlin 3 652 160598 0.01 Mutator 10 397 99572 0.01 P 35 28807 4859952 0.28 PIF 30 38609 7054230 0.40 piggyBac 76 108314 21178514 1.20 Tc1mariner 48 83789 13289414 0.75 MITEs 234 343838 87535895 4.96 m2bp 17 24668 6492577 0.37 m3bp 7 7033 1537791 0.09 m4bp 88 127330 31503909 1.78 m5bp 2 1225 414964 0.02 m6bp 3 7523 1738704 0.10 m7bp 3 7746 1198574 0.07 m8bp 22 56732 18130019 1.03 m9bp 2 4802 892191 0.05 mTA 90 106779 25627166 1.45 Unclassified 98 20073 5849509 0.33 Total 1289 1379140 294717617 16.69 This table represents a conservative estimation of the repeat content because we focused on manually annotated TEs. Annotation of long TEs is especially difficult given the fragmented nature of the genome assembly. Tandem repeats and satellite sequences are not included. TE copy numbers and base pairs were obtained by running RepeatMasker version 3.2.9 with the Ixodes scapularis TE library (available for download from the TEfam database at: http://tefam.biochem.vt.edu) and VectorBase (https://www.vectorbase.org/). Supplementary Table 14. Summary of transposable elements identified in the Ixodes scapularis coding sequence. Class Total Families Total Sequences Bases Occupied Percent Genome Class I L1 1,773 1,980 137,648,067 6.55 Ty3_gypsy 1,644 1,867 67,124,477 3.20 Penelope 290 328 18,329,691 0.87 Pao Bel 81 97 3,988,612 0.19 Rnase_H 24 26 164,423 0.01 Class II piggyBac 80 90 8,723,874 0.42 PIF 40 43 7,637,650 0.36 hAT 102 129 7,538,310 0.36 Mariner 74 91 6,280,194 0.30 P 54 58 6,054,528 0.29 Mutator 19 56 188,089 0.01 Merlin 3 3 160,327 0.01 Unclassified (mostly fragments) 1,338 2,693 40,366,119 1.92 Total 5,522 7,461 304,204,361 14.49 A transposable element genomic search was devised by (1) doing Psiblast of the coding regions of representatives of the diverse families of transposable elements against the non-redundant database from NCBI; (2) constructing matrices from the alignments to be used by the tool rpsBLAST; (3) by retrieving genomic matches by rpsBLAST against this database that are larger than 500 nt and e value < 1e -15 , with additional 500 nt of flanking regions; (4) finding terminal repeats (direct and inverted) and trimming the sequences accordingly (sequence without repeats are trimmed on their coding sequences); (5) by clusterizing the data set of 7,461 elements that have 90% identity over 90% of its length to obtain 5,522 clusters of elements, then (6) comparing the consensus sequences by BLAST to several databases and (7) finally running a program to classify these elements. The obtainied sequequences were compared to the genome to identify the number of bases occupied by this representative set. Supplementary Table 15. Summary of fluorescent in situ hybridization (FISH) to Ixodes scapularis ISE18 cell line chromosome spreads using BAC clone probes. Probes included only fully sequenced and assembled BAC clones from the 10X BAC clone library. D=Dispersed signal; S=Specific signal; I=Inconsistent result. Genbank Accession BAC Size(bp) 10X BAC Library Plate/Well FISH Result AC192414 117688 5/A1 D AC192415 122081 33/A1 D AC192416 107486 36/A1 D AC192417 102815 40/A1 D AC192418 114701 41/A1 D AC192419 113880 43/A1 D AC192420 146997 45/A1 D AC192421 137443 49/A1 D AC192422 135954 51/A1 D AC192423 109798 53/A1 D AC192424 144952 55/A1 D AC192425 145957 60/A1 D AC192426 117608 64/A1 S AC192427 98661 66/A1 D AC192428 106828 67/A1 D AC192429 136633 68/A1 D AC192742 133074 48/A1 D AC192743 130937 54/A1 D AC192744 115169 61/A1 D AC200531 77162 2/A1 D AC205630 95257 1/F14 D AC205631 108628 1/P2 D AC205632 26509 3/K2 I AC205633 97628 3/P2 I AC205634 112417 6/P2 S AC205635 104824 11/P2 D AC205636 106471 12/P2 D AC205637 131925 14/C7 D AC205638 100378 15/P2 D AC205639 92483 16/P2 D AC205640 109665 22/P2 I AC205641 179341 24/P2 D AC205642 110473 27/P2 S AC205643 128247 31/P2 D AC205644 110010 37/P2 D AC205645 120505 41/M8 D AC205646 122242 42/P2 D AC205647 115710 43/E15 D AC205648 126704 44/P2 D AC205649 111949 47/P2 D AC205650 107316 56/P2 D AC205651 172110 58/P2 D AC205652 50437 62/P2 D AC205653 108041 63/P2 D AC205654 14567 69/P2 I Supplementary Table 16. Summary of protein domains identified in Ixodes scapularis sialome sequences. Group No. a Group Name Mol. Wt. (kDa) Proposed Gene No. b Is Hs Bt Gg Aa Cq Ag Dm Ce At Function c 3 Kunitz domain- containing peptides Multiples of 8 30 74 26 28 7 5 5 4 30 57 0 Anti-clotting 13b Selenoproteins 15 3 2 4 2 1 1 1 1 1 1 1 Presumed antioxidant 13b Alkyl hydroperoxide reductase 28 3 6 23 8 5 6 6 6 10 4 11 Detoxification 8 Metalloproteases 55 3 34 108 71 38 9 14 10 19 8 0 Fibrinolytic 25b Dipeptidyl peptidase 60 2 7 7 8 3 9 8 10 7 1 0 Kininase 12b Defensin 6 2 8 13 29 12 4 1 2 1 0 0 Immunity 17b Cystatin 14 2 13 30 23 9 2 0 0 4 3 11 antiinflammatory, immunosuppressor 17c Serpin 24 2 44 115 80 31 32 48 25 44 11 12 Serine protease inhibitor 25a Serine proteases Various 2 133 293 154 77 392 448 321 283 12 0 Specificity unknown 17a TIL domain peptide 11 2 23 16 7 15 23 13 23 11 29 0 Unknown 25c Phospholipase A2 Truncated 1 2 2 2 2 5 1 1 1 0 0 Specificity unknown 13a Glutathione peroxidase 25 1 8 15 7 4 3 4 5 4 10 8 Presumed antioxidant 26b Antigen 5 35 1 12 38 13 11 35 30 19 22 34 22 Unknown 26a Ixoderin 30 1 27 61 26 34 35 92 49 22 7 0 Immunity 12a GGY repeat family d 4.7-13 Various families Unknown, possibly antimicrobial 18 Mucins e Various Various families Unknown 10 Ixostatin 9-11 25 11 unknown 15 WC-10 family 9-11 21 4 Unknown 11 Lipocalins 18-24 20 40 Kratagonist 16 LPTS family 12-16 11 0 Unknown 4 Proline/Glycine rich peptides 6-8 10 24 Unknown 7 9 and 7 kDa family 7-9 10 12 Unknown 6 5.3 kDa family 5.3 9 6 Antimicrobial 1 Basic tail polypeptides 13-14 8 16 Anti-clotting 9 Ixodegrin (RGD containing peptides) <4 5 10 Probable platelet aggregation inhibitor 14 Anticlomplement Isac 16 4 1 Anticomplement 19 IS6 family 9-12 4 2 Unknown 2 Basic tailless polypeptides 10-11 3 included in group 1 Unknown 20 12 kDa family 12 3 2 Unknown 5 18.7 kDa family 19 2 4 Unknown 12c Microplusin 13 2 15 Antimicrobial 21 26 kDa family 26 2 2 Unknown 23 Toxin like, may be related to IS6 8-9 2 1 Unknown 24 SRAEL family 16-22 2 2 Unknown 25d Small ribonuclease 6 1 1 Unknown 22 30 kDa family 30 1 20 Unknown a Based on 64 . The supplemental table can be obtained from http://exon.niaid.nih.gov/transcriptome/Ix_scapularis_sialome_2005/Sup-tables/Sup- table-2.xls. b Proteins that are >90% divergent in amino acid sequence. c Based on at least one member of a protein family that has been functionally analyzed. d Heterogeneous family,with poor primary sequence conservation, but having GGY repeats. e Heterogeneous family having in common solely over 10 N-acetyl-galactosylation sites. Aa, Aedes aegypti; Ag, Anopheles gambiae; At, Arabidopsis thaliana; Bt, Bos taurus; Ce, Caenorhabditis elegans; Cq, Culex quinquefasciatus; Dm, Drosophila melanogaster; Gg, Gallus gallus; Hs, Homo sapiens; Is, Ixodes scapularis. Supplementary Table 17. List of putative immune-related genes identified in the Ixodes scapularis genome. Immune pathway and gene Gene description I. scapularis supercontig # Base pair range on supercontig Genbank accession # Toll Pathway Dorsal Embryonic polarity dorsal DS612897 344,672-368,433 ISCW000140 Cactus NF-kappaB inhibitor IkappaB DS807313 DS789268 89,019-110,525 14,144-34,799 ISCW019520 ISCW007030 Pelle serine-threonine protein kinase DS633730 60,689-76,958 ISCW001463 Tube cyclin T-dependent kinase CDK9 DS787602 500,517-518,860 ISCW007160 MyD88 myd88 DS831454 19,812-43,217 ISCW008802 Toll toll toll toll toll toll toll toll toll toll toll DS894332 DS795254 DS692880 DS863226 DS795254 DS725696 DS795254 DS695149 DS794567 DS851201 370,864-378,206 164,145-173,413 318,809-322,642 213,685-217,374 116,582-121,636 4,704-5,021 130,237-135,616 145,084-147,147 257,906-260,571 446,328-461,671 ISCW022740 ISCW007727 ISCW018193 ISCW020989 ISCW007724 ISCW017724* ISCW007726** ISCW004495** ISCW008289** ISCW020221** Spätzle spatzle alternatively spliced isoform 11.27 Sptzle 1B DS924847 DS915052 58,310-78,232 406,105-422,910 ISCW022569 ISCW022732 Imd pathway Caudal homeobox protein cdx DS839652 4,771-4,947 ISCW008954 Relish nuclear factor nf- kappa-B P105 subunit DS737890 107,162-147,186 ISCW018935 IKK gamma protein kinase DS711115 74,892-92,974 ISCW003529 IKK beta inhibitor of nuclear factor kappa-B kinase alpha DS684865 34,555-75,124 ISCW002130 TAK1 tak1 DS956364 46,654-69,194 ISCW023496 TAB2 conserved hypothetical protein DS831661 125,422-146,802 ISCW009346 POSH conserved hypothetical protein DS980186 71,040-94,158 ISCW015192 Caspar regulator of the ubiquitin pathway DS635599 608,153-631,045 ISCW015648 Effete ubiquitin protein ligase DS734834 71,859-74,198 ISCW018551 Bendless ubiquitin protein ligase DS734517 102,190-115,886 ISCW006743 Uev1a ubiquitin-conjugating enzyme DS755574 226,269-228,921 ISCW019147 IAP2 inhibitor of apoptosis protein 1 and 2 DS874571 17,481-47,594 ISCW010694 RNAi pathway Dicer dicer-1 dicer-1 DS643033 DS643033 158,526-187,719 191,838-226,069 ISCW000889 ISCW000890 Argonaute translation initiation factor 2C DS620030 DS879840 DS903494 DS887784 DS906490 375,533-385,847 1,146-17,131 161,089-164,329 612,740-615,223 52,601-76,044 ISCW015916 ISCW011768 ISCW022696 ISCW021130 ISCW013378 FMRP HyFMR DS662130 57,130-96,383 ISCW002912 VIG vasa intronic gene DS630348 7,046-19,031 ISCW000538 Tudor-SN 4SNc-Tudor domain protein DS947409 53,618-100,428 ISCW014289 Armitage Conserved hypothetical protein DS771975 54,521-70,842 ISCW019555 Aubergine Cniwi protein Cniwi protein DS692353 DS861388 8,438-10,987 229,689-253,854 ISCW004464 ISCW011373 Rm62 ATP-dependent RNA helicase DS668332 DS668332 DS819551 17-18,383 27,837-64,710 52,974-68,087 ISCW002701 ISCW002703 ISCW009472 JAK/STAT pathway JAK (Hopscotch) Tyrosine protein kinase DS636921 613,020-649,592 ISCW016158 STAT Stat3 DS736534 85,785-110,372 ISCW005692 JAK receptor (Domeless) Receptor protein tyrosine phosphatase DS672509 132,429-173,396 ISCW016699 PIAS Sumo ligase DS741077 191,455-212,512 ISCW005295 SOCS SOCS box SH2 domain-containing protein DS788896 252,388-253,269 ISCW019435 Other immune- related genes Akirin Protective antigen D48/subolesin DS936446 66,643-89,471 ISCW023283 Antimicrobial peptides (AMPs)*** AMP AMP scapularisin secreted salivary gland peptide microplusin preprotein microplusin preprotein DS766801 DS858447 DS766801 DS766801 DS700881 DS683675 7,539-10,842 10,615-12,036 805-4,569 37,932-40,936 37,354-41,025 11,851-16,401 ISCW005927 ISCW011162 ISCW005926 ISCW005928 ISCW004019 ISCW002113 Caspases**** caspase caspase caspase caspase DS689930 DS923722 DS980848 DS896168 4,952-18,616 42,757-57,807 29,397-36,907 55,609-67,445 ISCW003039 ISCW013172 ISCW015329 ISCW022545 Defensins preprodefensin preprodefensin preprodefensin preprodefensin defensin DS759251 DS664851 DS929532 DS633368 DS930883 1,299-2,130 77,757-80,159 1,258-2,470 480-1,253 134,844-141,980 ISCW024381 ISCW016747 ISCW022594 ISCW024015 ISCW022102 Duox dual oxidase 1 DS798980 38,754-135,685 ISCW007865 Fibrinogen-related proteins ixoderin precursor ixoderin precursor ixoderin precursor ixoderin precursor ixoderin precursor DS662660 DS929502 DS959741 DS860650 DS899572 9,473-15,818 1,407-13,639 7,679-17,815 948-6,195 85,691-93,595 ISCW002664 ISCW012248 ISCW013746 ISCW024686 ISCW022063 Lysozymes lysozyme lysozyme lysozyme C-type lysozyme DS613145 DS613145 DS844216 DS670557 77,141-77,891 47,267-56,398 51,691-65,539 67,058-72,249 ISCW001646 ISCW001645 ISCW020680 ISCW017129 NADPH oxidase NADPH oxidase DS690902 246,606-271,833 ISCW002630 Peptidoglycan Recognition Receptors (PGRPs) PGRP Ammonium transporter PGRP PGRP DS686855 DS861599 DS697694 DS904186 766-1,809 1-805 122,963-124,835 380,517-387,075 ISCW024175 ISCW024689 ISCW004389 ISCW022212 Thio-ester containing proteins (TEPs) TEP alpha-2 macroglobulin alpha-2 macroglobulin alpha-2 macroglobulin conserved DS837598 DS790028 DS970697 DS716413 DS687147 DS779097 3,653-100,934 75,581-99,146 293,496-343,165 7,286-62,557 35,629-71,042 53,866-97,786 ISCW020822 ISCW019887 ISCW023777 ISCW003923 ISCW003089 ISCW007141 * Sequence only shows the Toll/Interleukin-1 receptor domain (TIR) but no leucine-rich repeats (LRRs). ** Sequence only shows LRRs but no TIR domain. *** AMPs include all the sequences uncovered as AMPs but that were not annotated as “defensins”. **** These sequences represent caspases that share similarity with death related ced-3/Nedd2-like protein (Dredd caspase). hypothetical protein alpha-2 macroglobulin Supplementary Table 18. Genes in the Ixodes scapularis genome with similarity to the enzymes involved in the mevalonate/farnesyl PP and JH pathways in insects. Top BLAST result Enzyme Scaffold (bp range) VectorBase Accession Organism (GenBank Accession) e-value Amino Acid Identity Farnesyl-PP pathway Acetoacetyl-CoA thiolase DS624476 (15968-41821) ISCW016117 Dendroctonus ponderosae (AFI45001) 4e-170 (61%) HMG-S a DS690902 (31998-46779) ISCW002615 Nasonia vitripennis (XP_003426942) 9e-169 (68%) HMG-R b DS842351 (4797-71147) ISCW009466 Pediculus humanus corporis (XP_002428525) 0.0 (55%) Mevalonate kinase DS735207 (298570-308399) ISCW018716 Camponotus floridanus (EFN64406) 4e-60 (35%) Phosphomevalonate kinase DS881578 (239893-241993) ISCW021370 Acromyrmex echinatior (EGI169273) 1e-44 (42%) Diphosphomevalonate decarboxylase DS921134 (457048-474172) ISCW022273 Apis mellifera (XP_001121619) 7e-122 (51%) Isopentenyl diphosphate isomerase not found not found not found not found Geranyl diphosphate synthase not found not found not found not found Farnesyl diphosphate synthase DS834911 (53770-59211) ISCW009264 Dendroctonus jeffreyi (AAX78435) 2e-96 (47%) JH Pathway Farnesyl diphosphate pyrophosphatase not found not found not found not found Farnesol oxidase DS838300 (597086-612073) ISCW020246 Ceratosolen solmsi marchali (XP_011505480) 1e-99 (60%) Farnesal dehydrogenase not found not found not found not found Methyltransferase DS624614 (1302-5354) ISCW000145 Schistocerca gregaria (ADV17350) 4e-18 (29%) JH c epoxidase not found not found not found not found a Hydroxymethylglutaryl-CoA synthase. b Hydroxymethylglutaryl-CoA reductase. c Juvenile hormone. Supplementary Table 19. Putative Ixodes scapularis genes associated with ecdysone synthesis and the ecdysone receptor. Gene name VectorBase Accession Scaffold Coordinates on Scaffold (bp) CYP307A1 (Spook) CYP307B1 (SPOT) CYP307A2 (Spookier) ISCW024795 DS931697 106..1604 ISCW006980 DS782423 5612..12969 CYP306A1 (Phantom) ND CYP302A1 (Disembodied) ND CYP315A1 (Shadow) ISCW021866 DS864024 44582..49687 CYP314A1 (Shade) ISCW021011 DS857608 115434..126481 ISCW001527 DS638370 30627..62 Ecdysone receptor ISCW003147 DS667471 104353..111170 Supplementary Table 20. Summary of Ixodes scapularis aminolevulinic acid (ALA) synthesis, proto-heme synthesis and heme degradation pathways. Enzyme Gene VectorBase Accession Scaffold Transcript Evidence GenBank Accession Gene Identified in REIS ALA synthase Aminolevulic acid synthase hemA - - - + Glutamyl-tRNA synthase † gltX ISCW018719 DS735207 Dv syn YP_001857605.1 + Glutamyl-tRNA reductase gtrA/hemA - - Dv ov YP_002306262.1 - Glutamate-1- semialdehyde 2,1- aminotransferase hemL - - - + Aminolevulic acid dehydratase hemB - - - + Porphobilinogen deaminase hemC - - - + Uroprophyrinogen-III synthase hemD - - - + Uroporphyrinogen decaroxylase hemE - - - + Corproporphyrinogen III oxidase hemF ISCW010977 ISCW006377 DS891848 DS752864 - - + hemN - - - + Protoporphyrinogen IX oxidase hemG ISCW023396 DS626813 Is syn NP_001167359 + hemY - - - - Ferrochelatase hemH ISCW016187 DS626813 Dv syn ZP_03286863.1 + Heme oxygenase hemO - - Is syn XP_002711461 - Biliverdin reductase - - -- - - Protoheme IX farnesyl transferase cyoE ISCW008907 DS846584 Ot syn XP_002411071.1 - ALA, -aminolevulinic acid; REIS, Rickettsia endosymbiont of Ixodes scaplaris 10 ; syn, syngalnglion transcriptome; ov, ovary transcriptome, Dv, Dermacentor variabilis; Is, I. scapularis; Ot, Ornithodorus turicata; † peptide evidence (see supplemental text). Supplementary Table 21. List of Ixodes scapularis hemoglobin digesting genes and gene annotations1 Function Gene name Vector base accession no. Scaffold Scaffold coordinates (bp) Gene length (bp) Transcript Length (bp) Length (AA) No. Exons Primary hemoglobin cleavage Cathepsin D (Aspartic protease) IscW_ISCW023880 DS949737 152,273- 190,227 37954 1179 392 1 IscW_ISCW013185 DS900056: 10,899-23,895 12,996 963 320 8 IscW_ISCW003823 DS722875: 17,354-32,869 15,515 1100 345 6 Cathepsin L (Cysteine protease endopeptidase) IscW_ISCW024899 DS970886 4,733-5,116 5313 383 127 1 Cathepsin L (Cysteine protease endopeptidase) IscW_ISCW000076 DS629804 3,735-4,818 1,083 300 99 2 Legumain (Aspartic endopeptidase) IscW_ISCW015983 DS621767 1,225-3,192 14,974 1968 446 1 Secondary hemoglobin cleavage Cathepsin B (Endopeptidase) IscW_ISCW005981 DS754946 9,428-18,454 9,026 672 223 5 Cathepsin L (Cysteine protease endopeptidase) IscW_ISCW024899 DS970886 4,733-5,116 5313 383 127 1 IscW_ISCW024213 DS704563 4,637-6,606 9464 255 84 1 Tertiary hemoglobin cleavage Cathepsin C (Aminodipeptidase) IscW_ISCW003494 DS694733 169,868- 186,056 16,188 1,080 352 7 Cathepsin B (Endopeptidase) IscW_ISCW005981 DS754946 9,428-18,454 9,026 672 223 5 Final hemoglobin cleavage SCP (Serine carboxypeptidase) IscW_ISCW021184 DS88627 64,978-83,896 18,918 1705 473 4 IscW_ISCW006427 DS752045 233-3,375 3,142 1125 374 2 IscW_ISCW010371 DS886430 77,615-100,122 22,507 1431 476 6 IscW_ISCW007492 DS725233 346-7,634 7,288 1416 471 4 LAP (Leucine aminopeptidase) IscW_ISCW0023735 DS967246 117,498- 141,675 24,177 1590 529 11 1Legend: Hemoglobin is digested intracellularly in specialized lysosome (hemosomes, see Fig. 1D). The digestive pathway comprises four major cleavage processes. 1) Primary digestion of the globin moieties into large fragments by the aspartic proteases Cathepsin D and legumain, supported by the cysteine endopeptidase Cathepsin L; 2) digestion of the resulting large peptide fragments (8 -11 kDa) by the endopeptidases Cathepsin B and Cathepsin L, resulting in intermediate size fragments (~ 5 – 7 kDa); 3) digestion of the intermediate size fragments by Cathepsin C and B resulting in small fragments (~ 3 – 5 kDa); 4) digestion of the small peptide fragments by SCP and LAP, liberating free amino acids and dipeptides. Free heme resulting from hemoglobinase activity is inactivated by forming large hematin-like aggregates that accumulate inside the hemosomes123. Supplementary Table 22. Summary of Ixodes scapularis hemelipoglyco-carrier protein (CP) and vitellogenin (Vg) gene annotations. † Incomplete gene model. I. scapularis Gene VectorBase Accession Scaffold Scaffold Coordinates (bp) Length (bp) Length (AA) No. Exons Hemelipoglyco-carrier Protein Genes CP 1 ISCW021709 DS853155 640,093-674,357 4,934 1,556 25 CP 2 † ISCW014675 DS946795 23,797-86,142 4,554 1,517 24 CP 3 † ISCW021710 DS853155 687,061-748,951 3,990 1,329 22 CP 4 † ISCW012424 DS930868 97,596-131,023 3,978 1,325 20 CP 5 † ISCW012423 DS930868 45,085-91,058 3,336 1,111 19 CP 6 † ISCW021704 DS853155 567,881-571,678 1,440 480 8 CP 7 † ISCW021707 DS853155 617,028-622,418 845 265 4 CP 8 † ISCW021706 DS853155 567,881-571,678 460 153 3 CP 9 † ISCW021705 DS853155 605,937-607,255 425 141 2 CP 10 † ISCW024299 DS725419 389-1,716 354 117 2 Vitellogenin Protein Genes Vg 1 ISCW013727 DS950603 16,225-44,518 4,935 1,644 26 Vg 2 ISCW021228 DS874548 255,397-286,108 5,811 1,936 22 Supplementary Table 23. Putative cytchrome P450 genes in the Ixodes scapularis genome. CYP2 Clan a VB Accession b CYP3 Clan VB Accession CYP4 Clan VB Accession CYP18C1 ISCW009830 CYP41A2 ISCW022948 CYP4W2 ISCW024589, ISCW024427 CYP307A1 ISCW006980, ISCW024795 CYP41B1 ISCW022672 CYP4W2- de10b11b ABJB010319121 CYP3001A1 ISCW002226 CYP41C1 ISCW022945 CYP3001A2 ISCW008379 CYP41C2 ISCW022947 CYP4W3 ISCW003279 CYP3001A3 ISCW003457 CYP41C3 ISCW019880 CYP4W4 ISCW022701, ISCW022702 CYP3001A4 ISCW004522 CYP41C4 EW786235.1, EW899917.1 CYP4W5 ABJB010639789.1 CYP3001A5 ABJB010183741.1 CYP41C5 ISCW019198 CYP4W6 ISCW013762 CYP3001A6 ABJB010948131.1 CYP41C6v1 ISCW024627 CYP4W7 ISCW017084 CYP3001A7 ABJB010161347.1 CYP41C6v2 ISCW011029 CYP4DL1 ISCW022695 CYP3001B1 ISCW016425 CYP41C7 ISCW022987 CYP4DL2 ISCW022697 CYP3001B2 EW827166.1, EW827167.1 CYP41C8 ISCW024413 CYP4DL3P ABJB010866300.1 CYP3001B3 ISCW006203 CYP41C9 ISCW000510 CYP4DL4 ISCW007225 CYP3001B4 ISCW006204 CYP41C10 ISCW010134, ISCW024611 CYP4DL4- de3b ABJB011028851 CYP3001B5 ISCW004521 CYP41C11 ISCW013318 CYP4DL5 EW922199.1 CYP3001B6 ISCW002182 CYP41C12 ISCW007389 CYP4DM1 ISCW022693 CYP3001B7 ISCW006219 CYP41C13 ISCW008554 CYP4DN1 ISCW024545 CYP3001B8 ISCW016424 CYP41C14 ISCW002138 CYP4DN2 ISCW022708 CYP3001B9 ABJB010987053.1 CYP41C15 ISCW003215 CYP4DP1 ISCW022706 CYP3001C1 ISCW022449 CYP41D1 ISCW008571 CYP4DP2 ABJB010524713.1 CYP3001C2 ISCW022451 CYP3004A1 ISCW018384 CYP4DQ1 DS865979, DS895862, DS714189 CYP3001D1 ISCW008112 CYP3004A2 ISCW018383 CYP4DR1 ISCW016620 CYP3001D2 ISCW013045 CYP3004A3 EW879600.1 CYP4DS1 ISCW005615 CYP3001D3 EW958870.1 CYP3004A4 EW959618.1 CYP4DS2 ISCW005544 CYP3001D4 ISCW024917 CYP3001B1 ISCW016424 CYP4DS3 ABJB010393473.1 CYP3001D5 ABJB010249968.1 CYP3004C1v1 ISCW022652 CYP4DS4 ISCW002003 CYP3001E1 ISCW007349 CYP3004C1v2 EW883126.1 CYP4DS5 ISCW010787 CYP3001F1 ISCW009779 CYP3004C2 ISCW022649 CYP4DS6 ISCW010786 CYP3001F2 ISCW006867 CYP3004C3P CYP3004D1 ISCW020210 ISCW001306, ISCW001307 CYP4DS7 ISCW010788 CYP3001G1 ISCW006936 CYP4DS8 ISCW019906 CYP3001G2 ISCW022148 CYP4DS9 ABJB010117553.1 CYP3001H1 ISCW005196 CYP3004D2 ISCW002936 CYP4DS10 ISCW002005 CYP3001H2 ABJB010355812.1 CYP3005A1 ISCW003160 CYP4DT1 ISCW016623 CYP3001J1 ISCW002317 CYP3005A2 DS799461.1 CYP319A3 ISCW022705 CYP3001K1 ISCW003266 CYP3005A3 ISCW004132 CYP319A4 DS764743 CYP3001L1 ISCW023771, ISCW006380 CYP3005A4 ISCW007953 CYP319A5 ISCW022704 CYP3001L2 ISCW012594 CYP3005A5 ISCW007954 CYP319A6v1 EW883950.1 CYP3001L3 ISCW018982 CYP3005A6 ISCW012000 CYP319A6v2 ISCW024808 CYP3001L4 ISCW015950 CYP3005A7 ISCW011997 CYP319A7 ISCW022703 CYP3001M1 ISCW017305 CYP3005A8 ISCW011996 CYP3001M2 ISCW017964 CYP3005A9 ISCW024674 CYP3001M3 ISCW017306 CYP3005A10 ISCW020282 Mito Clan CYP3001M4 DS798591 CYP302A1 ISCW010580 CYP3001N1 ISCW007262 CYP3005A11 ISCW011028 ISCW024197, CYP3012A1v1 ISCW001527 CYP3001N2 ISCW002062 CYP3005A12 ISCW008823 CYP3012A1v2 EW909080.1 CYP3001N3 EW887890.1, EW855831.1 CYP3005A13 ISCW024701 CYP3012A1v3 ABJB010790473.1 CYP3001N4 ABJB010068877.1 CYP3005A14 ISCW001241 CYP3012A1v4 EW834608.1 CYP3001P1 ISCW015055 CYP3005A15v1 ISCW024274 CYP3012A2 ABJB010381557 CYP3001P2 ISCW015054 CYP3005A15v2 ISCW024583 CYP3012A3 EW961943.1 CYP3001P3 ISCW006806 CYP3005A16 ISCW014319 CYP3012A4 ISCW008267 CYP3001Q1 ISCW012310 CYP3005A17 ISCW007367 CYP314A1 ISCW021011 CYP3001Q2 ISCW009178 CYP3005A18 ISCW004905 CYP315A1 ISCW021866, ISCW021867 CYP3001Q3v1 ISCW014782 CYP3005A19 ISCW008019 CYP3001Q3v2 ABJB010212140.1 CYP3005A20 ISCW001104, ISCW001105 CYP20 clan CYP3001R1 ISCW016133 CYP3005A21 ISCW001103 CYP20 ISCW015973, ISCW015974 CYP3001R2 ISCW005591 CYP3006A1 ISCW005198 CYP3001S1 ISCW014295 CYP3006B1 ISCW009640 CYP3002A1 ABJB010539647.1 CYP3006C1 ISCW012785 CYP3002A2 ISCW024473 CYP3006D1 ISCW014588 CYP3003A1 ISCW019785 CYP3006E1 ISCW001476 CYP3003A2 ISCW019784 CYP3006F1 ISCW001473 CYP3003A3 ISCW022069 CYP3006G1 ISCW007133 CYP3003A4 ISCW022070 CYP3006G2 ISCW007134 CYP3003A5 ISCW022071 CYP3006G3 EW786984.1, EL516481 CYP3003A5- de1b ABJB010494977.1 CYP3006G4 ISCW001622 CYP3003A6 ISCW022073 CYP3006G5 ISCW016204, ISCW016205 CYP3003A7 ISCW022075 CYP3003A8P ISCW022076 CYP3006G6 ISCW000235 CYP3003A9 ISCW022077 CYP3006G7P DS949456.1 CYP3006H1 ISCW001075 CYP3007A1 ISCW017673 CYP3007A2 EW793223.1, EW875640.1 CYP3007A3 ISCW014407 CYP3007A4 ISCW000434 CYP3007A5 EW886425.1 CYP3008A1v1 DS711134.1 CYP3008A1v2 ABJB010083687.1 CYP3008A1v3 ABJB010429442.1 CYP3008A2 ISCW003335 CYP3008A3 ISCW010505 CYP3008B1 DS884020 CYP3009A1 ISCW016385 CYP3009A2 DS641118 CYP3009A3 ISCW016388 CYP3009A4 DS641118 CYP3009A5 ISCW016389 CYP3009A6 DS641118 CYP3009A7 DS641118 CYP3009A8 ISCW016390 CYP3009A9 ISCW016392 CYP3009A9- de11b12b DS641118 CYP3009A10 ISCW016393 CYP3009A10- de6b DS641118 CYP3009A11 DS641118 CYP3009A12 ISCW015064 CYP3009A13 ISCW013158 CYP3009A14 ISCW007317 CYP3009B1 ISCW007380 CYP3009B2 ISCW011357 CYP3009B3 ISCW023575 CYP3009C1 ISCW016395 CYP3009D1 ISCW015040 CYP3009D2v1 ISCW015041 CYP3009D2v2 ISCW009986 CYP3009D3 ISCW003934 CYP3009D4 DS641118 CYP3009D5P DS641118 CYP3009D6 ISCW016397 CYP3009D7 ISCW005328 CYP3009D8 EW899738.1, EW899739.1 CYP3010A1 ISCW001418 CYP3010B1 ISCW010002, ISCW010003 CYP3011A1 ISCW006560 CYP3011A2v1 EW797008.1, EW883539.1 CYP3011A2v2 ISCW012810 CYP3011A3 ISCW009136 a The clans are higher level clades of genes. Ticks have five clans (including CYP20). The 2 clan has 68 entries with one possible allele (v2). P or –dexxx on the end of a name indicates a pseudogene. (de- indicates detritus exon adjacent to a parent gene, the numbers 10b11b etc indicate the exons that are present). The 2 clan has 2 pseudogenes, 1 variant and 65 genes. The 3 clan has 5 pseudogenes, 7 variants and 100 genes. The 4 clan has 3 pseudogenes, 1 variant and 33 genes. The mito clan has 3 variants and 7 genes. The 20 clan has only 1 gene. There are a total of 206 P450 genes. Halloween genes are (CYP302A1 [disembodied gene (dib)], CYP307A1 [spook (spo)], CYP314A1 [shade (shd)], CYP315A1 [shadow (sad)]). CYP18A1 in Drosophila melanogaster has 26 hydroxylase activity and is essential for metamorphosis 185 . b VectorBase accession numbers include ISCW gene model numbers if available, if there is no gene model, contig accessions ABJB01XXXXXXX.1 or scaffold accessions DSXXXXXX or ESTs EWXXXXXX.1 are given. Supplementary Table 24. Putative carboxylesterase genes Identified in the Ixodes scapularis genome Classification VectorBase Accession Number Protein Length † Ixodes scapularis Scaffold Base Pair Range on Scaffold Carboxylesterase/ AChE-like ISCW012483 654 DS901690 148,125..169,517 ISCW007849a 651 DS807640 41,806..55,016 ISCW020835a, b 647 DS812474 15,574..21,604 ISCW020833a 640 DS818569 257,240..263,338 ISCW011400a 634 DS859680 251,048..253,591 ISCW011399a 632 DS859680 183,448..185,998 ISCW012339b, c 623 DS907147 57,074..98,844 ISCW020830a, b, c 620 DS818569 213,005..222,326 ISCW022870b 617 DS903315 33,354..35,307 ISCW001079 592 DS638237 347,645..356,732 ISCW003637b 586 DS727378 78,715..80,741 ISCW005431b 564 DS758735 7,074..13,075 ISCW022246b 558 DS921995 692,289..694,852 ISCW017638b 557 DS717196 297,489..301,318 ISCW006617b 556 DS737125 63,964..67,823 ISCW020819a 555 DS839663 26,717..48,021 ISCW022251a 547 DS921995 896,844..900,843 ISCW021541a, c 542 DS889213 16,369..23,464 ISCW022244a 538 DS921995 665,765..669,060 ISCW013353 534 DS904610 25,924..28,794 ISCW020832a 524 DS818569 238,942..245,039 ISCW020825a, c 518 DS818569 60,968..62,524 ISCW003278c 517 DS685100 11,465..21,610 ISCW001132b 504 DS639501 286,801..288,315 ISCW001748b 504 DS631740 5,492..7,006 ISCW010310b 500 DS819927 6,796..8,298 ISCW020821a, b 499 DS839663 94,462..97,065 ISCW009205b 499 DS828756 4,652..6,151 ISCW006206a, b 499 DS770580 30,210..38,997 ISCW006896 494 DS789758 5,982..7,560 ISCW015340b 493 DS976673 38,037..39,518 ISCW004315b 483 DS694420 58,222..59,673 ISCW022252a 481 DS921995 912,311..927,215 ISCW019926 480 DS798293 1,550,582..1,572,844 ISCW024484 471 DS773540 719..2,131 ISCW024669 467 DS867945 499..1,899 ISCW007848a 464 DS807640 28,185..29,576 ISCW022036 461 DS926387 907,297..921,121 ISCW024395 460 DS750145 5,506..6,889 ISCW002384b 452 DS663061 396,472..397,830 ISCW010323 432 DS833783 42,994..59,925 ISCW006205a 425 DS770580 425..4,231 ISCW014784 421 DS945247 9,272..12,166 ISCW020826a 413 DS818569 102,860..112,799 ISCW021542a, c 388 DS889213 47,182..54,677 ISCW007846a 358 DS807640 11,151..12,224 ISCW003776 356 DS731177 27,172..46,710 ISCW022253a 354 DS921995 933,635..943,599 ISCW020829a 348 DS818569 133,597..151,342 † Gene models ranked in order of descending amino acid length of conceptual protein. a Denotes scaffold containing two or more carboxylesterase gene models. b Denotes potentially complete gene model. c Denotes putative acetylcholinesterase; AChE, acetylcholinesterase. ISCW015477 330 DS980614 7,699..11,969 ISCW001875 325 DS671188 563,450..582,923 ISCW020818a 311 DS839663 18,224..21,291 ISCW020837a 287 DS812474 41,993..42,853 ISCW009994 281 DS822211 2,541..12,634 ISCW022255a 279 DS921995 1,025,904..1,026,740 ISCW020827a 279 DS818569 123,253..124,089 ISCW011398a 279 DS859680 180,717..181,553 ISCW001837a 272 DS683640 413,937..414,752 ISCW023613a 270 DS963588 441,327..442,136 ISCW020828a 259 DS818569 128,594..129,370 ISCW022256a 250 DS921995 1,059,602..1,060,351 ISCW021543a 250 DS889213 54,792..55,544 ISCW022245a 245 DS921995 682,492..684,860 ISCW000833 228 DS629490 41,992..45,753 ISCW015220 227 DS974313 721..11,930 ISCW009289 227 DS841411 1,826..9,546 ISCW020834a 217 DS818569 273,050..276,739 ISCW006376 207 DS768980 5,026..13,061 ISCW022249a 202 DS921995 846,363..846,968 ISCW024894 188 DS932732 484..1,047 ISCW020831a 186 DS818569 228,504..229,808 ISCW004947 141 DS728330 428..4,745 ISCW022250a 128 DS921995 870,943..875,528 ISCW014233 118 DS937587 97..453 ISCW007945a 113 DS788282 16,722..17,682 Carboxylesterase ISCW019824 391 DS796655 26,651..39,339 Juvenile Hormone Esterase ISCW016978 412 DS654645 97,242..121,428 ISCW022078 276 DS892946 257,260..279,544 Pyrethroid- Metabolizing Carboxylesterase ISCW014411 530 DS971257 10,154..12,726 ISCW014780 503 DS967860 56,802..58,313 ISCW022961b 491 DS939604 711,415..712,890 ISCW023610a 489 DS963588 305,840..327,886 ISCW023611a 431 DS963588 334,284..355,108 ISCW023612a 359 DS963588 380,390..381,538 ISCW007946a 255 DS788282 22,248..23,305 ISCW024448 246 DS793560 222..962 ISCW001836a 208 DS683640 406,591..413,763 ISCW022937 183 DS971562 177,536..178,574 ISCW023615a 155 DS963588 451,386..452,909 Supplementary Table 25. Putative neuropeptide genes in Ixodes scapularis. Neuropeptide Genes Scaffold Scaffold Coordinates (bp) VectorBase Accession Achatin-like (GFGE) DS940350 23019..23117 NA AKH/corazonin-related peptide DS968442 24720..24893 NA Allatostatin A DS971562 340315..339812 ISCW022939 Allatostatin B (myoinhibitory peptide) DS704057 214860..217973 ISCW017595 Allatostatin C DS617680 26756..26517 ISCW001803 Allatosattin CC DS614450 94160..93978 ISCW001408 Allatotropin DS723986 69897..74019 ISCW017791 Vasopressin/Oxytocin-like (inotocin) a DS955335 731..757 NA DS655913 50489..50686 NA Bursicon alpha DS725348 327154..329168 ISCW004617 Bursicon beta DS725348 334706..336760 ISCW004618 CAPA (Pyrokinin / periviscerokinin) DS798279 53447..57119 ISCW019582 c CCAP DS863512 155818..156096 ISCW010619 CCHamide-1 a DS920188 DS721341 4270..1925 944..1070 ISCW013057 Corazonin DS968442 4830..8114 ISCW014429 Calcitonin-like diuretic hormone 1 DS849364 213812..229510 ISCW020490 Calcitonin-like diuretic hormone 2 DS833812 290964..308120 ISCW009341 Corticotropin-releasing factor-related diuretic hormone b DS951787 DS793410 1112..1534 18053..18115 ISCW007845 Eclosion hormone DS652454 187087..184932 ISCW001941 EFLamide DS945230 55463-66354 ISCW014582 Glycoprotein A2 b DS850534 41653..41751 NCBI prediction DS669550 1333..1046 DS957846 12481..12573 Glycoprotein B5 DS860962 49721..66736 ISCW010926 Insulin like peptide (ILP4) DS687889 56659..72302 ISCW002549 Ion transport peptide DS934076 108540..97467 ISCW023228 Kinin DS680282 583..1410 ISCW024200 1 Neuroparsin DS781496 23994..25192 NA Orcokinin DS860349 8710..8450 ISCW010518 1 Proctolin DS752645 23044..97988 ISCW005701 1 PTTH-like DS624571 79215..96811 ISCW001809 RYamide DS762742 10487...40630 ISCW005825 SIFamide DS939604 10166..18491 ISCW022950 Short neuropeptide F a DS682464 DS800964 1..104 20299..20852 ISCW007409 Sulfakinin DS674693 50707..50498 NA Tachykinin a DS805407 DS714254 18901..16589 229..80 ISCW008383 Trissin DS706258 980-1054 Novel Putative Neuropeptide Genes c FLVamide DS925401 117227..115863 NA GTVamide-1 a DS641015 1037..1 NA DS726073 1037..1 NA DS871441 73..5 GTVamide-2 DS873396 117488..117156 NA IRLamide DS963481 1316..567 NA LHFamide DS918990 378863..381517 ISCW012656 LHFa/AVFamide b DS918990 305627..305271 ISCW000205 DS647107 913..1149 LRFamide DS810236 227458..231328 ISCW019773 d PWGamide DS680282 715..1383 ISCW024200 QFTa/QFAa/QLTamide DS810352 3..1431 NA QFAa/ HFAa/QLTamide a DS799148 921..19 NA DS699187 1175..1 NA QFAa/QVKamide DS658524 979..2 NA a The gene likely spans multiple scaffolds (and multiple predictions) b Possible allelic forms of two scaffolds. c Predicted based on the repeated short peptides with C-terminal amidation canonical signals (GR or GK). These peptides do not have homology with other known, insect neuropeptides. d Predictions that need to be corrected for the reading frame. NA=Not found in computationalannotation. Supplementary Table 26. List of G protein-coupled receptors (GPCRs) identified in Ixodes scapularis. GPCR class GPCR subclass GPCR family I. scapularis GPCR I. scapularis scaffold Coordinates on scaffold (bp) VectorBase accession (1) Class A-Rhod(opsin) receptor family Amine receptors Dopamine GPRdop1 † DS648196 133,404-134,681 ISCW001496 GPRdop2 † DS812273 247,251-248,624 ISCW008775 GPRdop3_1 DS715310 294,120-294,563 ISCW005105 GPRdop3_2 DS748057 13,854-13,963 ISCW006077 GPRdop3_3 DS978565 1,946-10,664 ISCW015254 GPRdop3_4 DS834842 11,072-11,233 ISCW008917 Muscarinic acetylcholine mAChR1 DS660344 46,915-48,657 ISCW001961 mAChR2 DS968008 135,220-137,700 ISCW014424 Octopamine/Tyramine GPRoa1 † DS729026 32,100-33,527 ISCW003835 GPRoa2 † DS847958 146,790-147,929 ISCW008552 GPRtyr1 † DS964012 103,184-104461 ISCW013655 GPRtyr2 † DS728699 4690-5811 ISCW005195 Serotonin GPR5ht1 DS756593 240,283-253,629 ISCW019072 GPR5ht2 DS883764 16,244-17,440 ISCW020906 GPR5ht3 DS666028 398,996-400,363 ISCW017050 GPR5ht4 DS756593 157,071-160,431 ISCW019070 Peptide receptors ACP ACP-R1 † DS874502 36,974-42,229 ISCW011612+NEW ACP-R2 † DS635143; DS675617; DS797600 68,533-69,052; 21664-21,867; 569-1124 ISCW001755+ ISCW003272+ ISCW008018 ACP-R3 † DS786800 296,857-297,402; 441,895-445,805 ISCW019339+ ISCW019342 ACP-R4 † DS679693; DS621023 139,339-139,860; 55,588-58,021 ISCW017422+ ISCW000658 ACP-R5 DS641985 30,478-31,447 ISCW000195 ACP-R6 DS908815 64,376-64,909 ISCW013251 Allatotropin AT-R DS978161 73,824-74,264 ISCW015323+ ISCW015322 Allatostatin (A) Ast-A-R1 DS627425 21,088-22,374 ISCW001334 Ast-A-R2 DS616747 171,212-172,466 ISCW016381 Ast-A-R3 DS616747 216,452-217,633 ISCW016382 Ast-A-R4 DS946344 139,992-141,146 ISCW014938 Allatostatin (B) Ast-B-R1 DS814451 498,437-516,130 ISCW008779-A Ast-B-R2 DS814451 498,437-516,130 ISCW008779-B Allatostatin (C) Ast-C-R DS789528 6,027-12,848 ISCW007666 Bursicon Burs-R DS641526 219,850-250,933 ISCW015788 Capa/CAP2b/Periviscerokinin Capa-R1 † DS640702; DS713265; DS713265; DS674949; DS980147 9,628-9,977; 1,470-1,694; 18-304; 1,541-1,674; 14,584-15,105 ISCW000633+NEW+ ISCW015219 Capa-R2 DS902408 45-15,095 ISCW012018 Capa-R3 DS967049 68,951-69,238 ISCW014181 CCAP CCAP-R1 DS642648 32,147-35,927 ISCW000563 CCAP-R2 DS902282 1,720-11,529 ISCW013454 CCAP-R3 DS713552 1,900-18,499 ISCW004135 CCAP-R4 DS881571 21,179-21,656 ISCW011686 CCHamide-1 CCHa1-R DS955040 343,318-344,424 ISCW015075 Corazonin CRZ-R1 † DS862522; DS753205 337,666-338,286; 99,573-100,052 ISCW010571+ ISCW006212 CRZ-R2 DS743283 73,952-74,512 ISCW005601 GPA2/GPB5 LGR1-A DS776412 12,445-14,686 ISCW007539 LGR1-B DS670197 19,910-20,201 ISCW001983 Inotocin IT-R1 † DS658583 333,292-352,021 ISCW016651 IT-R2 † DS811967 34,737-35,711 ISCW008700 IT-R3 † DS802003 16,558-17,508 ISCW007179 Kinin Kin-R1 † DS915052 240,714-241,681; 53,234-53,339; 49,154-49,247; 45,556-45,826; ISCW022730+ ISCW022728 Kin-R2 DS915052 769,801-769,880; 803,104-803,316 ISCW022739 Kin-R3 DS915406 62,791-63,588 ISCW022222 Kin-R4 DS972284 15,019-15,848 ISCW015326 Myosuppressin MS-R DS710828 131-1,127 ISCW004636 Proctolin Proct-R DS711613 287,447-289,213; 289,343-291,511 ISCW017865+ ISCW017866 Pyrokinin PK-R* DS929178 1,062,985-1,063,966 ISCW022759+ ABJB011125851 RYamide RYa-R1 DS816975 121,888-122,667; 34,779-35,090 ISCW020603+ ISCW020601 RYa-R2 DS816975 9,435-9,878 ISCW020600 SIFamide SIFa-R DS721695 449,641-450,381; 563,784-566,715 ISCW017837+ ISCW017839 Short Neuropeptide F sNPF-R1 DS646881 88,703-90,025 ISCW000923 sNPF-R2 DS646881 90,611-91,642 ISCW000924 Sulfakinin SK-R1 DS748459 41,702-49,507 ISCW005570 SK-R2 DS822900 6,468-9,788 ISCW009627 SK-R3 DS909250 840,577-842,643 ISCW022781 SK-R4 DS747369 8,639-37,302 ISCW005948 SK-R5 DS671072 3,595-6,522 ISCW001892 SK-R6 DS784565 1,046-55,113 ISCW007293 SK-R7 DS648932 8,474-11,106 ISCW001201 Tachykinin TK-R1 DS848485 50,750-51,163; 102,898-133,431 ISCW010010+ ISCW010011 TK-R2 DS969660 233,259-233,744; ISCW013545+ 96,620-97,175 ISCW013543 TK-R3 DS787613 187,848-188,293 ISCW007598 TK-R4 DS966520 9,416-9,925 ISCW013598 TK-R5 DS643864 392,493-428,777 ISCW015892 TK-R6 DS765493 118,152-120,504 ISCW006511 TK-R7 DS754151 181,199-209,245 ISCW005553 TK-R8 DS641764 8,595-8,791 ISCW000039 TK-R9 DS747089 177,811-178,007 ISCW006476 TK-R10 DS649700 31,210-31,421 ISCW001766 Trissin Trissin-R1 DS746403 46,424-55,835 ISCW006418 Trissin-R2 DS812310 49,622-55,240 ISCW009718 Purine receptors Adenosine GPRads1 DS751891 15-731 ISCW006710 GPRads2 DS857834 851,959-852,927 ISCW021342 GPRads3 DS688131 171,862-193,233 ISCW002246 (Rhod)opsin receptors Long GPRop1_1 DS655566 780-1051 NEW GPRop1_2 DS631721 363-641 NEW GPRop1_3 DS955589 190-451 NEW GPRop1_4 DS681879 565-876 NEW Unknown GPRop2_1 DS727386 14108-17853 ISCW004568 GPRop2_2 DS647038 58-387 NEW Pteropsin GPRop3 DS748823 19,086-19,376 ISCW005498 Orphan/Putative Class A GPCRs GPRorp1 DS834336 4,245-8,992 ISCW009595 GPRorp2 DS928128 52-732 ISCW011905 GPRorp3 DS885437 65,156-92,934 ISCW021283 GPRorp4 DS854897 42,286-78,035 ISCW020998 GPRorp5 DS895157 172,724-173,425 ISCW022377 GPRorp6 DS810236 58,185-65,642 ISCW019770 GPRorp7 DS961247 253,289-254,266 ISCW014455 GPRorp8 DS694733 137,237-138,349 ISCW003493 GPRorp9 DS758491 336,265-339,216 ISCW018984 GPRorp10 DS799887 152,872-154,406 ISCW007873 GPRorp11 DS622494 210,268-238,098 ISCW000432 GPRorp12 DS794020 20,137-20,862 ISCW007619 GPRorp13 DS957018 374,567-374,881 ISCW023266 GPRorp14 DS819573 1,022-9,833 ISCW008691 GPRorp15 DS895157 130,408-130,773 ISCW022376 GPRorp16 DS727732 6,810-7,274 ISCW018171 GPRorp17 DS718929 48,953-50,059 ISCW004650 GPRorp18 DS695281 139,310-140,419 ISCW018273 GPRorp19 DS651746 89,066-90,402 ISCW015953 GPRorp20 DS849590 246,992-248,101 ISCW010126 GPRorp21 † DS978744 75,826-92,419 ISCW015218+NEW GPRorp22 DS664726 6,762-7,730 ISCW002641 GPRorp23 DS909250 807,932-809,260 ISCW022779 GPRorp24 DS951856 59,174-59,443 ISCW013584 GPRorp25 DS933420 12,704-13,765 ISCW014824 GPRorp26 DS626219 6,965-8,056 ISCW000606 GPRorp27 DS822291 20,914-22,134 ISCW010179 GPRorp28 DS847080 82-553 NEW GPRorp29 DS794029 116-365 NEW GPRorp30 DS957063 1,197-1,356 NEW GPRorp31 DS622115 720-804 NEW GPRorp31 DS734036 1,535,022-1,543,165 ISCW018990 GPRorp32 DS848412 15,099-15,401 ISCW009648 GPRorp33 DS673067 5,821-6,303 ISCW002847 GPRorp34 DS923672 7,604-8,503 ISCW013090 GPRorp35 DS825031 28,068-29,836 ISCW009568 GPRorp36 DS915257 2,800-28,037 ISCW013383 GPRorp37 DS708537 221,842-297,739 ISCW018360 GPRorp38 DS930058 108,838-109,239 ISCW013211 GPRorp39 GPRorp40 DS755450 DS848412 72,170-87,450 15099-15401 ISCW006089 ISCW009648 GPRorp41 GPRorp42 GPRorp43 DS673067 DS923672 DS825031 5,821-6,303 7,604-8,503 28,068-29,836 ISCW002847 ISCW013090 ISCW009568 (2) Class B – Secretin receptor family Diuretic hormone receptors Calcitonin-like CT/DH-R1 * DS922272 17,085-30,991 ISCW012970 CT/DH-R2 DS687147 107,053-141,306 ISCW003092 CT/DH-R3 DS769661 26,884-146,275 ISCW018841 CT/DH-R4 DS711942 10,647-69,312 ISCW004902 CT/DH-R5 DS677381 25,745-78,149 ISCW017538 Corticotropin-releasing hormone-like (CRF-like) CRF/DH-R1* DS783174 89,137-131,136 ISCW007036 CRF/DH-R2a †‡ DS784114; DS789666 14,660-139,631; 100,614-100,769 ISCW007612; ISCW007615 CRF/DH-R2b DS704079 5,933-78,153 ISCW017942 CRF/DH-R3 DS758074 212,330-212,392 214,835-214,983 221,884-221,950 NEW NEW ISCW019068 CRF/DH-R4 DS793456 1,543-38,369 ISCW019312 CRF/DH-R5 DS810171 300-480 NEW Pigment dispersing factor receptor PDF-R1 DS668046 445,965-498,626 ISCW017309 PDF-R2 DS668046 721,274-777,173 ISCW017314 Orphan/ Putative Class B GPCRs GPRorp1 DS906776 30,788-78,611 ISCW012057 GPRorp2 DS909780 606,602-613,020 ISCW022534 GPRorp3 DS650442 28,460-36,150 ISCW016343 GPRorp4 DS650414 56,145-57,149 ISCW000074 GPRorp5 DS757053 175,008-192,421 ISCW005937 GPRorp7 DS929178 814,031-814,471 ISCW022757 GPRorp8 DS921316 47,452-59,327 ISCW012038 GPRorp9 DS714433 547,697-550,000 ISCW018246 GPRorp10 DS968865 1,339,830-1,340,321 ISCW023674 GPRorp11 DS968865 1,320,857-1,321,348 ISCW023671 GPRorp12 DS968865 1,338,700-1,339,191 ISCW023673 GPRorp13 DS646990 289,490-339,295 ISCW000464 GPRorp14 DS806217 91,135-151,617 ISCW019673 GPRorp15 DS627544 239,378-248,563 ISCW001355 GPRorp16 DS929508 189,207-239,610 ISCW012721 GPRorp17 DS756825 20,407-111,042 ISCW006717 GPRorp18 DS905169 68,799-70,697 ISCW022854 GPRorp19 DS885034 25,512-27,359 ISCW010897 GPRorp20 DS730006 701-1,822 ISCW004659 GPRorp21 DS674693 369,558-371,486 ISCW016899 GPRorp22 DS968865 1,272,426-1,274,804 ISCW023670 GPRorp23 DS958380 104-9,636 ISCW014021 GPRorp24 DS979492 46,128-46,284 ISCW015339 GPRorp25 DS788275 144-266 NEW (3) Class C – Metabotropic glutamate-like receptor family Metabotropic glutamate receptors GPRmgl1 DS827319 1,297-9,829 ISCW010068 GPRmgl2 DS837710 392,177-408,030 ISCW020530 GPRmgl3 DS727862 10,596-30,463 ISCW004657 GPRmgl4 DS687238 5,152-11,333 ISCW016808 GPRmgl5 DS908406 8,172-49,656 ISCW013154 GPRmgl6_1 DS614359 383,268-425,389 ISCW016580 GPRmgl6_2 DS614359 190,697-267,345 ISCW016579 GPRmgl7 DS814554 1,703-14,641 ISCW009984 GPRmgl8 DS686939 2,170-2,646 ISCW002379 GABA(B) receptors GPRgbb1 DS792523 21,774-51,362 ISCW019833 GPRgbb2_1 DS856995 432,245-455,920 ISCW021466 GPRgbb2_2 DS856995 551,946-568,013 ISCW021468 GPRgbb3 DS963588 123,993-201,680 ISCW023607 GPRgbb4_1 DS842011 316,154-318,677 ISCW020868 GPRgbb4_2 DS842011 205,862-222,694 ISCW020865 GPRgbb4_3 DS842011 165,731-169,913 ISCW020864 GPRgbb4_4 DS842011 92,375-140,091 ISCW020863 GPRgbb4_5 DS842011 33,574-49,385 ISCW020862 Orphan/Putative Class C GPCRs GPRorp1 DS959025 442,721-466,585 ISCW023311 GPRorp2 DS877997 216-1,225 ISCW011406 GPRorp3 DS696092 86,002-87,104 ISCW017670 GPRorp4 DS963588 471,884-472,447 ISCW023616 (4) Class D- Atypical 7TM proteins Frizzled GPRfz1 DS671553 112,320-113,984 ISCW003177 GPRfz2 DS624476 452,659-454,854 ISCW016122 GPRfz3 DS976137 33,694-34,746 ISCW015217 GPRfz4 DS702749 85,729-87,155 ISCW003981 GPRfz5 DS703155 48,275-50,017 ISCW004077 GPRfz6 DS708614 201,139-213,311 ISCW004862 GPRfz7 DS877147 771-1175 NEW Smoothened GPRsmo DS857340 534,668-554,150 ISCW021763 Starry night GPRstn DS931589 4,009-100,015 ISCW022151 The I. scapularis G protein-coupled receptors (GPCRs) are categorized according to their predicted class, subclass, and family. The scaffold number, annotation coordinates and the GenBank accession number (ISCW identifier) corresponding to each GPCR are provided. Abbreviations for GPCR nomenclature: ACP, AKH/corazonin-related peptide; adr, adrenergic; ads, adenosine; Ast, allatostatin; AT, Allatropin; Burs, bursicon; CT, calcitonin; Capa, Capa peptide; CCHa1, CCHamide-1; CCAP, cardioacceleratory peptide; cir, cirl/latrophilin; CRF, Corticotropin-releasing factor-like; CRZ, corazonin; dop, dopamine; fz, frizzled; gbb, gamma amino butyric acid B receptor (GABAB); GPA2, Glycoprotein hormone-alpha- 2; GPB5, glycoprotein hormone-beta-5; 5HT, 5-hydroxytryptamine/serotonin; IT, insect oxytocin/vasopressin-like peptide; LGR, leucine-rich repeat-containing GPCR; mACh, muscarinic acetycholine; mgl, metabotropic glutamate; mth, methuselah; MS, myosuppressin; sNPF, short neuropeptide F; npr, neuropeptide receptor; oa, octopamine; op, opsin; orp, orphan; pct, proctolin; pdf, pigment-dispersing factor; pth, parathyroid hormone; pyn, pyrokinin; rxn, relaxin/insulin-like; RYa, RYamide; SK, sulfakinin; SIFa, SIFamide; smo, smoothened; stn, stan/starry night; TK, tachykinin; tyr, tyramine. The gene models corresponding to Dop3_1-4 (D2-like dopamine receptor), GPRmgl6_1-2, GPRgbb2_1-2, and GPRgbb4_1-5 are believed to represent fragments of single genes split among different contigs. Similarly, Op1_1-4 are fragments of a single gene and confirmed by RT-PCR, and Op2_1 and Op2_2 represent overlapping portions of the same gene but assigned to different contigs, possibly due to an assembly error. Footnotes: † Entire cDNA cloned. ‡ N-terminus of CRF/DH-R2a includes gene model ISCW007615. * Partial cDNA clone NEW: not automatically annotated, but newly identified region. Supplementary Table 27. Summary of neuropeptides and neuropeptide GPCRs in Ixodes scapularis. Neuropeptide Neuropeptide Gene ID Neuropeptide GPCR Neuropeptide GPCR Gene ID and Transmembrane (TM) Domains TM1 TM2 TM3 TM4 TM5 TM6 TM7 ACP DS968442 ACP-R1 † ISCW011612 NEW ACP-R2 † ISCW001755 ISCW003272 ISCW008018 ACP-R3 † ISCW019339 ISCW019342 ACP-R4 † ISCW017422 ISCW000658 ACP-R5 ISCW000195 ACP-R6 ISCW013251 Allatotropin ISCW017791 AT-R ISCW015323 ISCW015322 Ast-A ISCW022939 Ast-A-R1 ISCW001334 Ast-A-R2 ISCW016381 Ast-A-R3 ISCW016382 Ast-A-R4 ISCW014938 Ast-B ISCW017595 Ast-B-R1* ISCW008779-A Ast-B-R2* ISCW008779-B Ast-C § ISCW001803 Ast-C-R ISCW007666 Ast-CC § ISCW001408 Bursicon a § ISCW004617 Burs-R ISCW015788 Bursicon b § ISCW004618 Capa Capa-R1 † ISCW000633 NEW ISCW015219 Capa-R2 ISCW012018 Capa-R3 ISCW014181 CCAP ISCW010619 CCAP-R1 ISCW000563 CCHamide-1 ISCW013057 CCHa1-R ISCW015075 Corazonin ISCW014429 CRZ-R1 † ISCW010571 ISCW006212 CRZ-R2 ISCW005601 CRF/DH ISCW007845 CRF/DH-R1 ISCW007036 CRF/DH-R2a †‡ ISCW007612 CRF/DH-R2b ISCW017942 CRF/DH-R3 NEW ISCW019068 CRF/DH-R4 ISCW019312 CRF/DH-R5 NEW CT/DH ISCW020490 CT/DH-R1 ISCW012970 ISCW009341 CT/DH-R2 ISCW003092 CT/DH-R3 ISCW018841 CT/DH-R4 ISCW004902 CT/DH-R5 ISCW017538 GPA2 § DS669550 LGR1-A ISCW007539 GPB5 § ISCW010926 LGR1-B ISCW001983 Inotocin DS955355 IT-R1 † ISCW016651 IT-R2 † ISCW008700 IT-R3 † ISCW007179 Kinin ISCW024200 Kin-R1 † ISCW022730 ISCW022728 Kin-R2 ISCW022739 Kin-R3 ISCW022222 Kin-R4 ISCW015326 Myosuppressin MS-R ISCW004636 PDF PDF-R1 ISCW017309 PDF-R2 ISCW017314 Proctolin ISCW005701 Proct-R ISCW017865 ISCW017866 Pyrokinin ISCW019582 PK-R ISCW022759 NEW RYamide ISCW005825 RYa-R1 ISCW020603 ISCW020601 RYa-R2 ISCW020600 SIFamide ISCW022950 SIFa-R ISCW017837 ISCW017839 sNPF ISCW007409 sNPF-R1 ISCW000923 sNPF-R2 ISCW000924 Sulfakinin DS674693 SK-R1 ISCW005570 SK-R2 ISCW009627 SK-R3 ISCW022781 SK-R4 ISCW005948 SK-R5 ISCW001892 SK-R6 ISCW007293 SK-R7 ISCW001201 Tachykinin ISCW008383 TK-R1 ISCW010010 ISCW010011 TK-R2 ISCW013545 ISCW013543 TK-R3 ISCW007598 TK-R4 ISCW013598 TK-R5 ISCW015892 TK-R6 ISCW006511 TK-R7 ISCW005553 TK-R8 ISCW000039 TK-R9 ISCW006476 TK-R10 ISCW001766 Trissin DS706258 Trissin-R1 ISCW006418 Trissin-R2 ISCW009718 † Entire cDNA cloned. ‡ N-terminus of CRF/DH-R2a includes gene model ISCW007615. * Original annotation contained two fused genes which have now been corrected (A+B). § These ligands use the same receptor. NEW: not automatically annotated, but newly identified region. Supplementary Table 28. Selection of neuropeptide and G protein-coupled receptor (GPCR) genes that have been expanded in Ixodes scapularis compared to other sequences in arthropods. Neuropeptide A. No. Neuropeptide Genes B. No. Peptide Copies in the Propeptide GPCRs C. No. GPCR Genes I. scapularis Other Arthropods I. scapularis Other Arthropods I. scapularis Other Arthropods ACP 1 1 1 1 ACP-Rs 6 1 Ast-A 1 1 4 1-35 Ast-A-Rs 4 1-2 Ast-B 1 1 3 1-6 Ast-B-Rs 2 1 Capa - 1 - 2-3 Capa-Rs 3 1 Corazonin 1 1 1 1 CRZ-Rs 2 1 CRF/DH 1 1 1 1 CRF/DH- Rs 5 1-2 CT/DH 2 1 1 1 CT/DH-Rs 5 1-2 Inotocin 1 1 1 1 IT-Rs 3 1 Kinin 1 1 19 1-8 Kin-Rs 4 1 PDF 1 1 1 1 PDF-Rs 3 1 sNPF 1 1 1 1-5 sNPF-Rs 2 1 Sulfakinin 1 1 2 2 SK-Rs 7 1-2 Tachykinin 1 1 4 4-11 TK-Rs 10 1-2 Trissin 1 1 1 1 Trissin-Rs 2 1 Genes expanded in I. scapularis relative to other sequenced arthropods are shaded in gray. The number of neuropeptide genes is not expanded in I. scapularis in comparison to other arthropods (Section A). The number of neuropeptides in the I. scaplaris kinin propeptide is expanded compared to other arthropods (Section B). Twelve neuropeptide GPCRs are expanded in number in I. scapularis in comparison to other arthropods (Section C). Supplementary Table 29. Details of the Ixodes scapularus gustatory receptor (IsGr) family genes and proteins. Columns are: Gene – the gene and protein name assigned (suffixes are PSE – pseudogene, NTE – N-terminus missing, CTE – C- terminus missing, INT – internal exon missing, FIX – assembly was repaired, JOI – gene model spans scaffolds; multiple suffixes are abbreviated to single letters); OGS – the official gene number in the 20,486 proteins in OGSv1 (prefix is ISCW); Supercontig – the v1 genome assembly supercontig ID (prefix DS); Coordinates – the nucleotide range from the first position of the start codon to the last position of the stop codon in the scaffold; Strand – + is forward and - is reverse; Introns – number of introns in coding region; AAs – number of encoded amino acids in the protein; Comments – comments on the OGS gene model, repairs to the genome assembly, and pseudogene status (numbers in parentheses are the number of obvious pseudogenizing mutations). Gene OGS Scaffold Coordinates Strand Introns AAs Comments Gr1FIX 018232 700356 130622-133945 + 3 403 Fix assembly gap Gr2FIX 011821 855368 2651->5255 + 3 399 Fix assembly gap Gr3FIX - 855368 <16600-25223 + 3 389 Fix assembly gap Gr4CTE - 855368 29556->30788 + 3 363 Last exon missing Gr5INT - 855368 50700-60493 - 3 365 Third exon missing Gr6CTE 011822 855368 78232->80092 + 3 367 Last exon missing Gr7INT - 855368 88901-90482 + 3 369 Third exon missing Gr8PSE - 855368 102468-103531 + 3 327 Pseudogene (10) Gr9 800162 855368 122988-129732 + 3 404 New gene model Gr10 800163 855368 160441-163747 + 3 394 New gene model Gr11FIX 011826 855368 172171-176518 + 3 409 Fix assembly Gr12FIX - 681555 <144303-147585 - 3 408 Fix assembly gap Gr13FIX - 681555 122727-130437 - 3 394 Fix assembly Gr14 800164 681555 110946-114435 - 3 406 New gene model Gr15 800165 681555 97115-99209 - 3 409 New gene model Gr16FIX - 681555 85287-92568 - 3 413 Fix assembly gap Gr17CTE - 681555 <68420-69367 - 1 316 Last three exons missing Gr18 800161 740051 6893-11542 + 3 394 New gene model Gr19FJ - 686724 82->1133 + 3 401 Join across two scaffolds - 797949 190->4652 - Fix gap between scaffolds Gr20JI - 615125 <1-677 - 3 305 Join across two scaffolds - 686967 <1-12718 + Part of exon one missing Gr21FIX - 848686 <7763-10335 + 3 401 Fix assembly gap Gr22PSE - 832595 17507-19366 + 3 393 Pseudogene (1) Gr23PSE - 832595 32755-34887 + 3 393 Pseudogene (5) Gr24 800167 938791 41333-43178 + 3 393 New gene model Gr25 800168 938791 80049-81932 + 3 393 New gene model Gr26 800166 853698 97706-99752 - 3 393 New gene model Gr27 800169 853698 89684-92137 - 3 393 New gene model Gr28 800170 853698 111225-112868 - 3 393 New gene model Gr29FIX - 743784 <1-539 - 3 393 Fix assembly gap Gr30FIX - 857335 219->1239 - 3 393 Fix assembly gap Gr31FIX - 960372 <1-1000 + 3 393 Fix assembly gap Gr32FIX - 682467 236->1431 + 3 388 Fix assembly gap Gr33 - 873761 45170-47981 + 2 387 Lost first intron Gr34 800171 873761 51055-55819 - 3 380 New gene model Gr35 800184 849364 15863-44702 + 3 379 New gene model Gr36INT 000403 626740 7238-16841 + 3 374 Second exon missing Gr37 018421 701157 1484-10355 + 6 372 Extra introns Gr38CTE 013468 908024 <17508-18416 - - 303 Last three exons missing Gr39CTE 014940 953252 1139->2071 + 1 311 Last three exons missing Gr40 800173 895205 28720-34708 + 3 397 New gene model Gr41JI - 976502 <1-1135 - 3 373 Join across two scaffolds 671510 176901->189177 - Second exon missing Gr42CTE 008702 827442 6174->7127 + 1 318 Last three exons missing Gr43CTE 008702 827442 8389->9369 + 1 327 Last three exons missing Gr44CTE 008702 827442 11273->12205 + 1 311 Last three exons missing Gr45CTE - 660244 1213->1959 + 1 249 Last three exons missing Gr46FC - 828673 <1->519 + - 200 Fix assembly gap Last three exons missing Gr47 800174 884190 15927-17192 - 0 421 New gene model Gr48 800175 663085 56946-58130 - 0 394 New gene model Gr49 800176 663085 62527-63657 + 0 376 New gene model Gr50 800177 966800 5785-7014 + 0 409 New gene model Gr51 800178 637704 96604-97833 - 0 409 New gene model Gr52 800179 931786 315480-316709 - 0 409 New gene model Gr53 800180 931786 328322-329596 - 0 424 New gene model Gr54 800181 940066 661113-662393 + 0 426 New gene model Gr55 800182 688611 441077-442354 - 0 425 New gene model Gr56 800183 775741 1373-2533 + 0 386 New gene model Gr57PSE - 907737 45413-46569 + 0 386 Pseudogene (8) Gr58PSE - 894387 688->1690 - 0 325 Pseudogene (9) Gr59NC 012263 921071 <111821->112591 + 0 257 Both ends missing Gr60NC - 663085 <72725->73345 - 0 200 Both ends missing Gr61 018260 714433 1067742-1076817 + 3 433 Fine as is Gr62CTE 011649 878513 <4955-17506 - 1 307 C-terminus missing Supplementary Table 30. Ixodes scapularis ionotropic glutamate receptors and ionotropic receptors Gene Name VectorBase Accession Scaffold Start Stop Length (bp) Introns Comments 1 Notes IscaAMPAR01 ISCW016542-PA DS647564 326210 285753 725 11 - No ATG IscaAMPAR02 novel DS852167 93345 41206 719 11 PSE 1 frameshift IscaAMPAR03 ISCW017534-PA DS674345 860787 894098 914 14 - IscaAMPAR04 ISCW017535-PA DS674345 896771 928186 878 12 - No ATG IscaIR25a ISCW008225-PA DS776301 656 15191 627 5 PSE, CTE 4 frameshifts. No ATG. Added N-term and C- term IscaIR270.1 ISCW014237-PA DS941993 1246 48375 526 6 INT IscaIR270.2 novel DS944343 445174 621659 770 8 INT IscaIR271 ISCW000549-PA DS643501 48779 30656 487 9 - IscaIR272 ISCW022000-PA DS917723 300652 307852 283 3 NTE No ATG. Added C-term, removed residues at N- term IscaIR273 ISCW006307-PA DS743451 18121 16238 628 0 - IscaIR274 ISCW015704-PA DS613622 176323 163863 398 5 NTE IscaIR275 ISCW020630-PA DS844967 256726 273694 429 5 NTE No ATG. Removed residues at N-term IscaIR276 ISCW022877-PA DS911299 93493 103589 454 6 - IscaIR277 ISCW001635-PA DS618314 1505 19198 448 7 - IscaIR278 ISCW015703-PA DS613622 146719 160224 423 7 - IscaIR279 ISCW019302-PA DS809877 693067 708183 376 4 NTE IscaIR280 ISCW015107-PA DS979414 264628 258457 354 4 NTE No ATG IscaIR281 ISCW010196-PA DS829427 63163 77406 347 5 NTE IscaIR93a ISCW007957-PA DS778079 2881 36116 659 9 - IscaKA01 ISCW023268-PA DS954809 79910 4181 736 13 CTE No ATG IscaKA02 novel DS683624 147641 132726 381 3 PSE, NTE, CTE 1 internal stop codon. No ATG IscaKA03 ISCW001842-PA DS664102 467895 401477 761 10 PSE 1 frameshift. No ATG. Few edits IscaKA04 ISCW023274-PA DS954809 715472 675153 808 12 - No ATG IscaKA05 ISCW008266-PA DS811111 136492 107642 870 12 - IscaKA06 ISCW012402-PA DS907449 324300 367939 728 11 CTE No ATG IscaKA07 ISCW008263-PA DS811111 21039 8427 264 3 NTE No ATG IscaNMDAR01 ISCW010976-PA DS891848 1499 36711 582 9 - Few edits. No ATG. Short? IscaNMDAR02 ISCW005598-PA DS758678 464306 409871 854 13 - Few edits. No ATG IscaNMDAR03 ISCW009282-PA DS834911 299979 287443 1114 9 - 1 PSE = pseudogene; NTE = N-terminal end missing; CTE = C-terminal end missing; INT = internal gap. Supplementary Table 31. Putative Cys-loop and ionotropic glutamate ligand-gated ion channels in the Ixodes scapularis genome. Ion Channel Acaricidal Compound Subunits Ixodes Subunits Drosophila Cys-loop ligand-gated ion channels Nicotinic acetylcholine receptors Spinosyn 12 10 GABA receptors Fipronil 4 3 Glutamate-gated anion channels Ivermectin 6 1 Histamine-gated anion channels Ivermectin 1 2 pH-sensitive anion channels Ivermectin 1 1 Other subunits 8 5 Ionotropic glutamate receptors AMPA 4 2 Kainate 7 10 NMDA 3 2 IRs 15† 66 † 30 additional short sequence fragments encoding potential IRs were also identified. Supplementary Table 32. Proteins identified by LC-MS/MS of ISE6-Anaplasma infected Ixodes scapularis ISE6 cells. EARLY INFECTION LATE INFECTION Over-expressed in infected cells N=13 Under-expressed in infected cells N=50 Cell growth 7.7%*,** Cell growth 20.0%*,** Protein metabolism 38.5% Protein metabolism 30.0% Nucleic acid metabolism 23.1% Nucleic acid metabolism 14.0% Transport 15.4% Transport 6.0% Energy metabolism 16.0% Cell communication 6.0% Lipid metabolism 0.0% Unknown 15.3% Unknown 8.0% Up regulated in infected cells N=8 Up regulated in infected cells N=31 Cell growth 12.5%*,** Cell growth 3.2%*,** Protein metabolism 37.5% Protein metabolism 38.7% Nucleic acid metabolism 25.0% Nucleic acid metabolism 25.8% Transport 0.0%* Transport 0.0%* Energy metabolism 9.7% Cell communication 3.2% Lipid metabolism 3.2% Unknown 25.0% Unknown 16.2% Biological process protein ontology of differentially represented proteins between infected and uninfected tick cells during early and late infections (* and ** indicate significant differences (p<0.05) between under- and over-representedproteins in both early and late infections and between early and late infections, respectively). Supplementary Table 33. Protein differential representation between Anaplasma phagocytophilum-early infected and control uninfected Ixodes scapularis ISE6 cells. FASTA Protein Description UNIPROT Protein Name Fold Change a FDR b Biological Process c Under-expressed in infected cells, N=13 tr|B7P2Q4|B7P2Q4_IXOSC Lamin, putative OS=Ixodes scapularis GN=IscW_ISCW000339 B7P2Q4| Laminin -2.53 0.000 Cell growth and/or maintenance tr|B7P7F7|B7P7F7_IXOSC Heat shock protein, putative OS=Ixodes scapularis GN=Isc B7P7F7| HSP -2.31 0.004 Protein metabolism tr|B7P9E4|B7P9E4_IXOSC Na+/K+ ATPase, alpha subunit, putative (Fragment) OS=Ixo B7P9E4| Na+/K+ ATPase, alpha subunit -2.14 0.000 Transport tr|B7P5B3|B7P5B3_IXOSC U5 snRNP-specific protein, putative (Fragment) OS=Ixode B7P5B3| U5 snRNP-specific protein -2.04 0.004 Protein metabolism tr|B7PMC3|B7PMC3_IXOSC Putative uncharacterized protein OS=Ixodes scapularis GN B7PMC3 Unknown -2.03 0.000 Unknown tr|B7P2T4|B7P2T4_IXOSC Ribosomal protein S17, putative OS=Ixodes scapularis GN B7P2T4| ribosomal protein S17 -1.95 0.004 Protein metabolism tr|B7PV22|B7PV22_IXOSC Poly [ADP-ribose] polymerase, putative OS=Ixodes scapul B7PV22| poly [ADP-ribose] polymerase -1.94 0.013 Unknown tr|B7QDV1|B7QDV1_IXOSC Histone, putative OS=Ixodes scapularis GN=IscW_ISCW01223 B7QDV1 histone -1.93 0.000 Nucleic acid metabolism tr|B7P595|B7P595_IXOSC Proline and glutamine- rich splicing factor (SFPQ), puta B7P595| proline and glutamine- rich splicing factor (SFPQ) -1.89 0.003 Nucleic acid metabolism tr|B7PR83|B7PR83_IXOSC Ubiquitin conjugating enzyme E1, putative OS=Ixodes scap B7PR83| ubiquitin conjugating enzyme E1 -1.82 0.000 Protein metabolism tr|B7P0P1|B7P0P1_IXOSC DNA topoisomerase 2 OS=Ixodes scapularis GN=IscW_ISCW01 B7P0P1| DNA topoisomerase II -1.65 0.002 Nucleic acid metabolism tr|B7QMV1|B7QMV1_IXOSC Elongation factor, putative OS=Ixodes scapularis GN=IscW B7QMV1 elongation factor 2 (eEF2) -1.50 0.000 Protein metabolism tr|B7P5X8|B7P5X8_IXOSC Voltage dependent anion selective channel, putative OS= B7P5X8| voltage-dependent anion- selective channel (mt) -1.33 0.028 Transport Over-expressed in Infected cells, N=8 tr|A6N9P0|A6N9P0_ORNPR 40S ribosomal protein S14 OS=Ornithodoros parkeri PE=2 S A6N9P0| ribosomal protein S14 + 1.69 0.000 Protein metabolism tr|B7Q0Q1|B7Q0Q1_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes sc B7Q0Q1 Unknown + 1.78 0.002 Unknown tr|B7PZ14|B7PZ14_IXOSC RNA binding protein, putative OS=Ixodes scapularis GN=I B7PZ14| RNA-binding protein + 1.83 0.011 Nucleic acid metabolism tr|B7P3Q5|B7P3Q5_IXOSC Vasa intronic protein, putative OS=Ixodes scapularis GN B7P3Q5| vasa intronic protein + 2.01 0.000 Nucleic acid metabolism tr|B7QD48|B7QD48_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes sc B7QD48| Unknown + 2.35 0.037 Unknown tr|B7PSQ6|B7PSQ6_IXOSC 40S ribosomal protein S3A, putative OS=Ixodes scapularis B7PSQ6 40S ribosomal protein S3A + 3.10 0.004 Protein metabolism tr|B2YGD3|B2YGD3_9ARAC Actin (Fragment) OS=Galianora bryicola PE=4 SV=1 B2YGD3 actin + 3.27 0.027 Cell growth and/or maintenance tr|B7PXR5|B7PXR5_IXOSC Chaperonin complex component, TCP-1 eta subunit, putativ B7PXR5| chaperonin complex component, TCP-1b eta subunit + 11.92 0.004 Protein metabolism a + indicates a significant increase in protein levels and - indicates a significant decrease in protein levels in infected cells (p < 0.05). b False discovery rate (FDR) associated to protein identification. c Protein ontology for biological process determined using human protein databases at: http://www.hprd.org / and http://www.ebi.ac.uk/interpro/ Supplementary Table 34. Protein differential representation between Anaplasma phagocytophilum-late infected and control uninfected Ixodes scapularis ISE6 cells. FASTA Protein Description UNIPROT Protein Name Fold Change a FDR b Biological Process c Under-expressed in infected cells, N=50 tr|B7P7F7|B7P7F7_IXOSC Heat shock protein, putative OS=Ixodes scapularis GN=Isc B7P7F7| HSP -5.81 0.004 Protein metabolism tr|B7P2Q4|B7P2Q4_IXOSC Lamin, putative OS=Ixodes scapularis GN=IscW_ISCW000339 B7P2Q4 Laminin B -5.64 0.000 Cell growth and/or maintenance tr|B7P595|B7P595_IXOSC Proline and glutamine- rich splicing factor (SFPQ), puta B7P595| proline and glutamine-rich splicing factor (SFPQ) -2.73 0.003 Nucleic acid metabolism tr|B7P0P1|B7P0P1_IXOSC DNA topoisomerase 2 OS=Ixodes scapularis GN=IscW_ISCW01 B7P0P1| DNA topoisomerase II -2.66 0.002 Nucleic acid metabolism tr|B7P9E4|B7P9E4_IXOSC Na+/K+ ATPase, alpha subunit, putative (Fragment) OS=Ixo B7P9E4| Na+/K+ ATPase, alpha subunit -2.38 0.000 Transport tr|B7P3D3|B7P3D3_IXOSC FKBP-type peptidyl- prolyl cis-trans isomerase, putative B7P3D3| FKBP-type peptidyl-prolyl cis-trans isomerase -2.27 0.037 Protein metabolism tr|B7P1C8|B7P1C8_IXOSC Protein hu-li tai shao, putative OS=Ixodes scapularis GN B7P1C8| protein hu-li tai shao, Adducin -2.17 0.000 Cell growth and/or maintenance tr|B7Q1Y2|B7Q1Y2_IXOSC 6-phosphogluconate dehydrogenase, decarboxylating (Frag B7Q1Y2 6-phosphogluconate dehydrogenase -2.15 0.003 Energy metabolism tr|B7P230|B7P230_IXOSC Translation initiation factor 2C, putative OS=Ixodes sc B7P230| translation initiation factor 2C -2.08 0.015 Protein metabolism tr|B7QDV1|B7QDV1_IXOSC Histone, putative OS=Ixodes scapularis GN=IscW_ISCW01223 B7QDV1 histone -2.06 0.000 Nucleic acid metabolism tr|B7P5B3|B7P5B3_IXOSC U5 snRNP-specific protein, putative (Fragment) OS=Ixode B7P5B3| U5 snRNP-specific protein -2.05 0.004 Protein metabolism tr|B7P8J4|B7P8J4_IXOSC ATP-dependent RNA helicase, putative (Fragment) OS=Ixode B7P8J4| ATP-dependent RNA helicase -2.02 0.027 Nucleic acid metabolism tr|B7PAS1|B7PAS1_IXOSC MCM2 protein, putative (Fragment) OS=Ixodes scapularis B7PAS1 MCM2; Predicted ATPase involved in replication control -1.99 0.010 Cell growth and/or maintenance tr|B7PSE0|B7PSE0_IXOSC Ribosomal protein L4, putative OS=Ixodes scapularis GN=I B7PSE0 ribosomal protein L4 -1.96 0.000 Protein metabolism tr|B7Q5Y2|B7Q5Y2_IXOSC Prohibitin, putative OS=Ixodes scapularis GN=IscW_ISCW0 B7Q5Y2 prohibitin -1.92 0.000 Cell communication; Signal transduction tr|B7PKP8|B7PKP8_IXOSC Spermidine synthase, putative OS=Ixodes scapularis GN=I B7PKP8 spermidine synthase -1.83 0.000 Energy metabolism tr|B7PKR5|B7PKR5_IXOSC Glutamyl-tRNA synthetase, cytoplasmic, putative OS=Ixode B7PKR5 glutamyl-tRNA synthetase -1.82 0.000 Protein metabolism tr|B7PQP7|B7PQP7_IXOSC Hydroxyacyl-CoA dehydrogenase, putative (Fragment) OS=Ix B7PQP7 hydroxyacyl-CoA dehydrogenase -1.81 0.000 Energy metabolism tr|B7PMC3|B7PMC3_IXOSC Putative uncharacterized protein OS=Ixodes scapularis GN B7PMC3 Unknown -1.81 0.000 Unknown tr|B7QC74|B7QC74_IXOSC Transcription factor containing NAC and TS-N domains, pu B7QC74 transcription factor containing NAC and TS-N domains -1.73 0.020 Nucleic acid metabolism tr|B7PKQ6|B7PKQ6_IXOSC Cell division protein, putative (Fragment) OS=Ixodes sca B7PKQ6 cell division protein -1.72 0.027 Cell growth and/or maintenance tr|B7QFX7|B7QFX7_IXOSC RAB-9 and, putative OS=Ixodes scapularis GN=IscW_ISCW021 B7QFX7 RAB-9, small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway -1.71 0.000 Cell communication; Signal transduction tr|B7PUR9|B7PUR9_IXOSC Failed axon connections, putative OS=Ixodes scapularis G B7PUR9 failed axon connections -1.69 0.000 Unknown tr|B7PA04|B7PA04_IXOSC Putative uncharacterized protein OS=Ixodes scapularis G B7PA04| Unknown -1.68 0.004 Unknown tr|B7PV22|B7PV22_IXOSC Poly [ADP-ribose] polymerase, putative OS=Ixodes scapul B7PV22| poly [ADP-ribose] polymerase -1.65 0.013 Unknown tr|B7PRG2|B7PRG2_IXOSC 60S acidic ribosomal protein P0, putative OS=Ixodes sca B7PRG2 60S acidic ribosomal protein P0 -1.62 0.044 Protein metabolism tr|B7P573|B7P573_IXOSC Processing peptidase beta subunit, putative OS=Ixodes sc B7P573| processing peptidase beta subunit -1.59 0.011 Protein metabolism tr|B7PIZ1|B7PIZ1_IXOSC GDI-1 GDP dissociation inhibitor, putative (Fragment) O B7PIZ1| GDI-1 GDP dissociation inhibitor -1.58 0.000 Cell communication; Signal transduction tr|B7P289|B7P289_IXOSC Prolyl 4-hydroxylase alpha subunit, putative OS=Ixodes s B7P289| prolyl 4-hydroxylase alpha subunit -1.58 0.003 Protein metabolism tr|B7PVI7|B7PVI7_IXOSC RNA-binding protein musashi, putative OS=Ixodes scapula B7PVI7| RNA-binding protein musashi -1.56 0.002 Nucleic acid metabolism tr|B7QMV1|B7QMV1_IXOSC Elongation factor, putative OS=Ixodes scapularis GN=IscW B7QMV1 elongation factor 2 (eEF2) -1.55 0.000 Protein metabolism tr|B7QM86|B7QM86_IXOSC Talin, putative OS=Ixodes scapularis GN=IscW_ISCW023338 B7QM86 Talin, cytoskeletal associated protein -1.51 0.000 Cell growth and/or maintenance tr|B7PCN1|B7PCN1_IXOSC Aldo-keto reductase, putative OS=Ixodes scapularis GN=Is B7PCN1 aldo-keto reductase -1.47 0.004 Energy metabolism tr|B7Q3Z3|B7Q3Z3_IXOSC 26S proteasome regulatory subunit rpn1, putative OS=Ixo B7Q3Z3| 26S proteasome regulatory subunit rpn1 -1.47 0.048 Protein metabolism tr|A4UTU3|A4UTU3_DERVA Beta-actin OS=Dermacentor variabilis PE=2 SV=2 A4UTU3 Beta actin -1.46 0.000 Cell growth and/or maintenance tr|B2D2D4|B2D2D4_9ACAR Translation elongation factor EF-1 alpha/Tu (Fragment) B2D2D4 Translation elongation factor EF-1 alpha/Tu -1.45 0.000 Protein metabolism tr|B7P1Z8|B7P1Z8_IXOSC Heat shock protein, putative OS=Ixodes scapularis GN=Is B7P1Z8| HSP -1.45 0.016 Protein metabolism tr|B7QMD6|B7QMD6_IXOSC Transaldolase, putative OS=Ixodes scapularis GN=IscW_ISC B7QMD6 transaldolase -1.43 0.000 Energy metabolism tr|B7QIJ3|B7QIJ3_IXOSC Quinone oxidoreductase, putative (Fragment) OS=Ixodes s B7QIJ3| quinone oxidoreductase -1.41 0.000 Energy metabolism tr|B7P5X8|B7P5X8_IXOSC Voltage-dependent anion-selective channel, putative OS= B7P5X8| voltage-dependent anion- selective channel (mt) -1.40 0.028 Transport tr|Q6X4W3|Q6X4W3_HAELO Actin OS=Haemaphysalis longicornis GN=Act1 PE=2 SV=1 Q6X4W3 Actin -1.40 0.000 Cell growth and/or maintenance tr|B7P1U8|B7P1U8_IXOSC Spectrin alpha chain, putative OS=Ixodes scapularis GN= B7P1U8| spectrin alpha chain, cytoskeletal protein -1.39 0.000 Cell growth and/or maintenance tr|B7PGM6|B7PGM6_IXOSC G-3-P dehydrogenase, putative (Fragment) OS=Ixodes scapu B7PGM6 Glyceraldehyde 3- phosphate dehydrogenase -1.39 0.000 Energy metabolism sp|Q8WQ47|TBA_LEPDS Tubulin alpha chain OS=Lepidoglyphus destructor PE=1 SV=2 |Q8WQ4 Alpha tubulin -1.37 0.000 Cell growth and/or maintenance tr|B7QMW0|B7QMW0_IXOSC Fatty acid-binding protein FABP, putative OS=Ixodes sca B7QMW0 fatty acid-binding protein FABP -1.34 0.000 Transport tr|A8UY20|A8UY20_9ACAR Elongation factor 1- alpha (Fragment) OS=Hypochthonius l A8UY20| elongation factor -alpha (eEF1a) -1.32 0.003 Protein metabolism tr|B7PG97|B7PG97_IXOSC Transcription factor NFAT, subunit NF45, putative (Frag B7PG97 transcription factor NFAT, subunit NF45 -1.31 0.011 Nucleic acid metabolism tr|B7PD56|B7PD56_IXOSC cyclophilin B precursor OS=Ixodes scapularis B7PD56| cyclophilin B precursor -1.31 0.003 Protein metabolism tr|B7Q0D4|B7Q0D4_IXOSC Fumarylacetoacetase, putative OS=Ixodes scapularis GN=Is B7Q0D4 fumarylacetoacetase -1.27 0.015 Energy metabolism tr|B7PA92|B7PA92_IXOSC Beta tubulin OS=Ixodes scapularis GN=IscW_ISCW017133 PE B7PA92| beta tubulin -1.27 0.003 Cell growth and/or maintenance Over-expressed in Infected cells, N=31 tr|B7PEN4|B7PEN4_IXOSC Heat shock protein, putative OS=Ixodes scapularis GN=Is B7PEN4 HSP70 + 1.20 0.011 Protein metabolism tr|B4YTT8|B4YTT8_9ACAR Heat shock protein 70-1 OS=Tetranychus cinnabarinus PE=2 B4YTT8| HSP70-1 + 1.30 0.002 Protein metabolism tr|B7Q6Z1|B7Q6Z1_IXOSC Saposin, putative B7Q6Z1| saposin + 1.37 0.000 Lipid metabolism OS=Ixodes scapularis GN=IscW_ISCW01159 tr|B4YTT9|B4YTT9_9ACAR Heat shock protein 702 OS=Tetranychus cinnabarinus PE= B4YTT9| HSP70-2 + 1.42 0.000 Protein metabolism tr|IscW_ISCW008184|IscW_ISCW008184 Calreticulin (Fragment) OS=Ixodes scapularis IscW_ISC W008184 calreticulin, chaperone activity + 1.46 0.000 Protein metabolism tr|B7P591|B7P591_IXOSC Phosphoribosylamidoimidazole succinocarboxamide synthas B7P591| phosphoribosylamidoimid azole- succinocarboxamide synthase + 1.46 0.000 Nucleic acid metabolism tr|B7PV15|B7PV15_IXOSC Glyoxylate/hydroxypyruvate reductase, putative OS=Ixodes B7PV15| glyoxylate/hydroxypyruvat e reductase + 1.48 0.000 Energy metabolism tr|B7PKH2|B7PKH2_IXOSC Mcm2/3, putative (Fragment) OS=Ixodes scapularis GN=Isc B7PKH2 minichromosome maintenance protein Mcm2/3 + 1.49 0.030 Nucleic acid metabolism tr|B7PBW3|B7PBW3_IXOSC Protein disulfide isomerase 1, putative OS=Ixodes scapu B7PBW3 protein disulfide isomerase 1 + 1.53 0.050 Protein metabolism tr|B7PEL0|B7PEL0_IXOSC Tetraspanin, putative OS=Ixodes scapularis GN=IscW_ISCW B7PEL0| tetraspanin + 1.57 0.000 Unknown tr|B7PRN8|B7PRN8_IXOSC Brain acid soluble protein, putative OS=Ixodes scapular B7PRN8 brain acid soluble protein + 1.58 0.018 Nucleic acid metabolism tr|A6N9M1|A6N9M1_ORNPR 40S ribosomal protein S2/30S OS=Ornithodoros parkeri PE= A6N9M1 40S ribosomal protein S2/30S + 1.68 0.017 Protein metabolism tr|B7PH44|B7PH44_IXOSC Malate dehydrogenase, putative OS=Ixodes scapularis GN=I B7PH44| malate dehydrogenase + 1.72 0.000 Energy metabolism sp|Q09JT4|RL38_ARGMO 60S ribosomal protein L38 OS=Argas monolakensis GN=RpL38 |Q09JT4 60S ribosomal protein L38 + 1.90 0.003 Protein metabolism tr|B7QF39|B7QF39_IXOSC Transcription factor Mbf1, putative OS=Ixodes scapulari B7QF39| Transcription factor Mbf1 + 2.02 0.003 Nucleic acid metabolism tr|B5M799|B5M799_9ACAR Histone H2B OS=Amblyomma americanum PE=2 SV=1 B5M799| Histone H2B + 2.06 0.048 Nucleic acid metabolism tr|B7QF45|B7QF45_IXOSC 3 ketoacyl CoA thiolase, putative OS=Ixodes scapularis B7QF45| 3-keto-acyl-CoA thiolase + 2.13 0.032 Protein metabolism tr|B7Q1Y8|B7Q1Y8_IXOSC Putative uncharacterized protein OS=Ixodes scapularis G B7Q1Y8 Unknown + 2.18 0.039 Unknown tr|B7PZ14|B7PZ14_IXOSC RNA binding protein, putative OS=Ixodes scapularis GN=I B7PZ14| RNA-binding protein + 2.20 0.011 Nucleic acid metabolism tr|B7Q5H9|B7Q5H9_IXOSC Fructose bisphosphate aldolase OS=Ixodes scapularis B7Q5H9 fructose 1,6-bisphosphate aldolase + 2.23 0.004 Energy metabolism GN=I tr|B7PHT2|B7PHT2_IXOSC Histone H2A OS=Ixodes scapularis GN=IscW_ISCW004478 PE= B7PHT2 Histone H2A + 2.72 0.000 Nucleic acid metabolism tr|B7Q645|B7Q645_IXOSC Secreted salivary gland peptide, putative (Fragment) OS B7Q645| secreted salivary gland peptide + 2.81 0.000 Protein metabolism tr|B7Q4T5|B7Q4T5_IXOSC Putative uncharacterized protein OS=Ixodes scapularis GN B7Q4T5| Unknown + 2.83 0.000 Unknown tr|B7Q0Q1|B7Q0Q1_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes sc B7Q0Q1 Unknown + 2.91 0.002 Unknown tr|B7PB95|B7PB95_IXOSC Stathmin OS=Ixodes scapularis GN=IscW_ISCW003366 PE=3 S B7PB95| stathmin + 2.96 0.000 Cell communication; Signal transduction tr|B7QD48|B7QD48_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes sc B7QD48 Unknown + 3.14 0.037 Unknown tr|A6N9P0|A6N9P0_ORNPR 40S ribosomal protein S14 OS=Ornithodoros parkeri PE=2 S A6N9P0| ribosomal protein S14 + 3.22 0.000 Protein metabolism tr|B7PKZ9|B7PKZ9_IXOSC BRI1 KD interacting protein, putative OS=Ixodes scapula B7PKZ9| BRI1-KD interacting protein + 3.98 0.014 Protein metabolism tr|Q86G66|Q86G66_DERVA Putative beta thymosin OS=Dermacentor variabilis PE=2 SV Q86G66 beta thymosin + 4.68 0.000 Cell growth and/or maintenance tr|B7P3Q5|B7P3Q5_IXOSC Vasa intronic protein, putative OS=Ixodes scapularis GN B7P3Q5 vasa intronic protein + 4.81 0.000 Nucleic acid metabolism tr|B7PXR5|B7PXR5_IXOSC Chaperonin complex component, TCP1 eta subunit, putativ B7PXR5 chaperonin complex component, TCP-1b eta subunit + 16.16 0.004 Protein metabolism a + indicates a significant increase in protein levels and - indicates a significant decrease in protein levels in infected cells (p < 0.05). b False discovery rate (FDR) associated to protein identification. c Protein ontology for biological process determined using human protein databases at: http://www.hprd.org / and http://www.ebi.ac.uk/interpro/ Supplementary Table 35. Protein identification in Ixodes scapularis ISE6 cells infected with Anaplasma phagocytophilum. FASTA protein Description Species No. Peptides a FDR b Proteins identified with FDR <1% tr|B7PEV0|B7PEV0_IXOSC Chaperonin subunit, putative OS=Ixodes scapularis GN=Isc Ixodes scapularis 12 0.000 sp|Q8WQ47|TBA_LEPDS Tubulin alpha chain OS=Lepidoglyphus destructor PE=1 SV=2 Lepidoglyphus destructor 10 0.000 tr|B7PEN4|B7PEN4_IXOSC Heat shock protein, putative OS=Ixodes scapularis GN=Isc Ixodes scapularis 10 0.000 tr|B7QI01|B7QI01_IXOSC Hsp90 protein, putative OS=Ixodes scapularis GN=IscW_IS Ixodes scapularis 9 0.000 tr|B7P1U8|B7P1U8_IXOSC Spectrin alpha chain, putative OS=Ixodes scapularis GN= Ixodes scapularis 8 0.000 tr|B7Q5X7|B7Q5X7_IXOSC Vinculin, putative OS=Ixodes scapularis GN=IscW_ISCW0214 Ixodes scapularis 8 0.000 tr|B7Q9F1|B7Q9F1_IXOSC Protein disulfide isomerase, putative OS=Ixodes scapular Ixodes scapularis 8 0.000 tr|B7QIT3|B7QIT3_IXOSC Putative uncharacterized protein OS=Ixodes scapularis GN Ixodes scapularis 7 0.000 tr|B7P8Q5|B7P8Q5_IXOSC Hsp70, putative (Fragment) OS=Ixodes scapularis GN=IscW Ixodes scapularis 6 0.000 tr|B7Q0J9|B7Q0J9_IXOSC Peptidyl-prolyl cis-trans isomerase OS=Ixodes scapulari Ixodes scapularis 6 0.000 tr|B7QAM1|B7QAM1_IXOSC Chaperonin complex component, TCP-1 theta subunit, putat Ixodes scapularis 6 0.000 tr|B7QC85|B7QC85_IXOSC Tumor rejection antigen (Gp96), putative (Fragment) OS=I Ixodes scapularis 6 0.000 tr|B7QM86|B7QM86_IXOSC Talin, putative OS=Ixodes scapularis GN=IscW_ISCW023338 Ixodes scapularis 6 0.000 tr|B7QMV1|B7QMV1_IXOSC Elongation factor, putative OS=Ixodes scapularis GN=IscW Ixodes scapularis 6 0.000 tr|B7P3Z6|B7P3Z6_IXOSC Chaperonin complex component, TCP-1 gamma subunit, putat Ixodes scapularis 5 0.000 tr|B7P4U1|B7P4U1_IXOSC Protein disulfide isomerase, putative OS=Ixodes scapular Ixodes scapularis 5 0.000 tr|B7PA92|B7PA92_IXOSC Beta tubulin OS=Ixodes scapularis GN=IscW_ISCW017133 PE= Ixodes scapularis 5 0.000 tr|B7PG97|B7PG97_IXOSC Transcription factor NFAT, subunit NF45, putative (Fragm Ixodes scapularis 5 0.000 tr|B7PN34|B7PN34_IXOSC KH domain RNA binding protein, putative (Fragment) OS=Ix Ixodes scapularis 5 0.000 tr|B7PUR9|B7PUR9_IXOSC Failed axon connections, putative OS=Ixodes scapularis G Ixodes scapularis 5 0.000 tr|B7PX63|B7PX63_IXOSC Zinc finger protein, putative OS=Ixodes scapularis GN=Is Ixodes scapularis 5 0.000 tr|B7Q0D4|B7Q0D4_IXOSC Fumarylacetoacetase, putative OS=Ixodes scapularis GN=Is Ixodes scapularis 5 0.000 tr|B7QE46|B7QE46_IXOSC ATP synthase subunit beta OS=Ixodes scapularis GN=IscW_ Ixodes scapularis 5 0.000 tr|B5AHF4|B5AHF4_9ACAR Heat shock protein 90 OS=Tetranychus cinnabarinus PE=2 S Tetranychus cinnabarinus 5 0.000 tr|A4UTU3|A4UTU3_DERVA Beta-actin OS=Dermacentor variabilis PE=2 SV=2 Dermacentor variabilis 5 0.000 tr|A0S0Q6|A0S0Q6_9ACAR Actin (Fragment) OS=Neoseiulus womersleyi PE=2 SV=1 Neoseiulus womersleyi 4 0.000 tr|B7P1Z8|B7P1Z8_IXOSC Heat shock protein, putative OS=Ixodes scapularis GN=Isc Ixodes scapularis 4 0.000 tr|B7PAR6|B7PAR6_IXOSC Heat shock protein, putative OS=Ixodes scapularis GN=Isc Ixodes scapularis 4 0.000 tr|B7PH44|B7PH44_IXOSC Malate dehydrogenase, putative OS=Ixodes scapularis GN=I Ixodes scapularis 4 0.000 tr|B7PIM5|B7PIM5_IXOSC CNDP dipeptidase, putative (Fragment) OS=Ixodes scapular Ixodes scapularis 4 0.000 tr|B7Q5G8|B7Q5G8_IXOSC Spectrin beta chain, putative OS=Ixodes scapularis GN=Is Ixodes scapularis 4 0.000 tr|B7Q5Y2|B7Q5Y2_IXOSC Prohibitin, putative OS=Ixodes scapularis GN=IscW_ISCW0 Ixodes scapularis 4 0.000 tr|B7QCK2|B7QCK2_IXOSC ATP synthase subunit alpha OS=Ixodes scapularis GN=IscW_ Ixodes scapularis 4 0.000 tr|B7QJ21|B7QJ21_IXOSC Chaperonin complex component, TCP-1 eta subunit, putati Ixodes scapularis 4 0.000 tr|B5M6E6|B5M6E6_HAPSC Beta tubulin OS=Haplopelma schmidti PE=2 SV=1 Haplopelma schmidti 4 0.000 tr|A1KXJ1|A1KXJ1_BLOTA Blo t Mag29 allergen OS=Blomia tropicalis PE=2 SV=1 Blomia tropicalis 3 0.000 tr|B7P0M7|B7P0M7_IXOSC Aldehyde dehydrogenase, putative (Fragment) OS=Ixodes s Ixodes scapularis 3 0.000 tr|B7P5X8|B7P5X8_IXOSC Voltage-dependent anion-selective channel, putative OS=I Ixodes scapularis 3 0.000 tr|B7PAB9|B7PAB9_IXOSC Methylmalonate semialdehyde dehydrogenase, putative OS=I Ixodes scapularis 3 0.000 tr|B7PDF3|B7PDF3_IXOSC FKBP-type peptidyl-prolyl cis-trans isomerase, putative Ixodes scapularis 3 0.000 tr|B7PHC3|B7PHC3_IXOSC Carbon-nitrogen hydrolase, putative OS=Ixodes scapularis Ixodes scapularis 3 0.000 tr|B7PHJ5|B7PHJ5_IXOSC Cytochrome b5 domain-containing protein, putative (Fragm Ixodes scapularis 3 0.000 tr|B7PKG2|B7PKG2_IXOSC Fasciclin domain-containing protein, putative OS=Ixodes Ixodes scapularis 3 0.000 tr|B7PKR5|B7PKR5_IXOSC Glutamyl-tRNA synthetase, cytoplasmic, putative OS=Ixode Ixodes scapularis 3 0.000 tr|B7PRN8|B7PRN8_IXOSC Brain acid soluble protein, putative OS=Ixodes scapular Ixodes scapularis 3 0.000 tr|B7PSE0|B7PSE0_IXOSC Ribosomal protein L4, putative OS=Ixodes scapularis GN=I Ixodes scapularis 3 0.000 tr|B7PV15|B7PV15_IXOSC Glyoxylate/hydroxypyruvate reductase, putative OS=Ixodes Ixodes scapularis 3 0.000 tr|B7Q5I4|B7Q5I4_IXOSC Multifunctional chaperone, putative OS=Ixodes scapulari Ixodes scapularis 3 0.000 tr|B7Q5L2|B7Q5L2_IXOSC Calponin, putative OS=Ixodes scapularis GN=IscW_ISCW021 Ixodes scapularis 3 0.000 tr|B7QEE0|B7QEE0_IXOSC Hypoxia up-regulated protein, putative OS=Ixodes scapula Ixodes scapularis 3 0.000 tr|B7QGH2|B7QGH2_IXOSC Glutathione S-transferase, putative OS=Ixodes scapularis Ixodes scapularis 3 0.000 tr|B7QMW0|B7QMW0_IXOSC Fatty acid-binding protein FABP, putative OS=Ixodes sca Ixodes scapularis 3 0.000 tr|B4YTT9|B4YTT9_9ACAR Heat shock protein 70-2 OS=Tetranychus cinnabarinus PE= Tetranychus cinnabarinus 3 0.000 tr|A6N9Z0|A6N9Z0_ORNPR Ubiquitin/40S ribosomal protein S27a OS=Ornithodoros par Ornithodoros parkeri 3 0.000 tr|A6NA14|A6NA14_ORNPR Truncated peroxiredoxin (Fragment) OS=Ornithodoros parke Ornithodoros parkeri 3 0.000 tr|B7P3B9|B7P3B9_IXOSC Lumican, putative OS=Ixodes scapularis GN=IscW_ISCW00102 Ixodes scapularis 2 0.000 tr|B7P3M8|B7P3M8_IXOSC D-3-phosphoglycerate dehydrogenase, putative (Fragment) Ixodes scapularis 2 0.000 tr|B7P427|B7P427_IXOSC Transmembrane protein Tmp21, putative OS=Ixodes scapular Ixodes scapularis 2 0.000 tr|B7P526|B7P526_IXOSC Reductase, putative OS=Ixodes scapularis GN=IscW_ISCW00 Ixodes scapularis 2 0.000 tr|B7P591|B7P591_IXOSC Phosphoribosylamidoimidazole-succinocarboxamide synthas Ixodes scapularis 2 0.000 tr|B7P5U7|B7P5U7_IXOSC Lon protease homolog (Fragment) OS=Ixodes scapularis GN= Ixodes scapularis 2 0.000 tr|B7PA04|B7PA04_IXOSC Putative uncharacterized protein OS=Ixodes scapularis GN Ixodes scapularis 2 0.000 tr|B7PA24|B7PA24_IXOSC Protein phosphatase 2A regulatory subunit A, putative OS Ixodes scapularis 2 0.000 tr|B7PBW3|B7PBW3_IXOSC Protein disulfide isomerase 1, putative OS=Ixodes scapul Ixodes scapularis 2 0.000 tr|B7PCL8|B7PCL8_IXOSC Hydroxysteroid (17-beta) dehydrogenase, putative OS=Ixo Ixodes scapularis 2 0.000 tr|B7PEU9|B7PEU9_IXOSC Heat shock protein OS=Ixodes scapularis GN=IscW_ISCW0178 Ixodes scapularis 2 0.000 tr|B7PEY5|B7PEY5_IXOSC Alanyl-tRNA synthetase, putative OS=Ixodes scapularis G Ixodes scapularis 2 0.000 tr|B7PGM6|B7PGM6_IXOSC G-3-P dehydrogenase, putative (Fragment) OS=Ixodes scapu Ixodes scapularis 2 0.000 tr|B7PIZ1|B7PIZ1_IXOSC GDI-1 GDP dissociation inhibitor, putative (Fragment) OS Ixodes scapularis 2 0.000 tr|B7PMY6|B7PMY6_IXOSC Actin depolymerizing factor, putative OS=Ixodes scapula Ixodes scapularis 2 0.000 tr|B7PTR3|B7PTR3_IXOSC Limbic system-associated membrane protein, putative OS=I Ixodes scapularis 2 0.000 tr|B7PUK8|B7PUK8_IXOSC Clathrin heavy chain, putative (Fragment) OS=Ixodes scap Ixodes scapularis 2 0.000 tr|B7PYE7|B7PYE7_IXOSC B-cell receptor-associated protein, putative OS=Ixodes s Ixodes scapularis 2 0.000 tr|B7Q0D5|B7Q0D5_IXOSC Pyruvate kinase OS=Ixodes scapularis GN=IscW_ISCW020197 Ixodes scapularis 2 0.000 tr|B7Q4P0|B7Q4P0_IXOSC Putative uncharacterized protein OS=Ixodes scapularis GN Ixodes scapularis 2 0.000 tr|B7Q4T5|B7Q4T5_IXOSC Putative uncharacterized protein OS=Ixodes scapularis GN Ixodes scapularis 2 0.000 tr|B7Q6Y2|B7Q6Y2_IXOSC Chaperonin subunit, putative OS=Ixodes scapularis GN=Is Ixodes scapularis 2 0.000 tr|B7Q8W6|B7Q8W6_IXOSC Alkyl hydroperoxide reductase, thiol specific antioxida Ixodes scapularis 2 0.000 tr|B7QAW3|B7QAW3_IXOSC Electron transfer flavoprotein, beta subunit, putative O Ixodes scapularis 2 0.000 tr|B7QBM8|B7QBM8_IXOSC Enoyl-CoA hydratase, putative OS=Ixodes scapularis GN=Is Ixodes scapularis 2 0.000 tr|B7QC74|B7QC74_IXOSC Transcription factor containing NAC and TS-N domains, pu Ixodes scapularis 2 0.000 tr|B7QFN6|B7QFN6_IXOSC Proliferating cell nuclear antigen OS=Ixodes scapularis Ixodes scapularis 2 0.000 tr|B7QGQ3|B7QGQ3_IXOSC Putative uncharacterized protein OS=Ixodes scapularis GN Ixodes scapularis 2 0.000 tr|B7QHT2|B7QHT2_IXOSC Profilin (Fragment) OS=Ixodes scapularis GN=IscW_ISCW023 Ixodes scapularis 2 0.000 tr|B7QIJ3|B7QIJ3_IXOSC Quinone oxidoreductase, putative (Fragment) OS=Ixodes s Ixodes scapularis 2 0.000 tr|B7QL57|B7QL57_IXOSC Adenylyl cyclase-associated protein OS=Ixodes scapulari Ixodes scapularis 2 0.000 tr|B7QLY6|B7QLY6_IXOSC Nucleoside diphosphate kinase OS=Ixodes scapularis GN=Is Ixodes scapularis 2 0.000 tr|B7QMD6|B7QMD6_IXOSC Transaldolase, putative OS=Ixodes scapularis GN=IscW_ISC Ixodes scapularis 2 0.000 tr|Q64K73|Q64K73_9ACAR Calreticulin (Fragment) OS=Ixodes woodi PE=3 SV=1 Ixodes woodi 2 0.000 tr|A5LHV9|A5LHV9_HAELO Protein disulfide isomerase-2 OS=Haemaphysalis longicorn Haemaphysalis longicornis 2 0.000 tr|A6N9S1|A6N9S1_ORNPR Thioredoxin peroxidase OS=Ornithodoros parkeri PE=2 SV= Ornithodoros parkeri 2 0.000 tr|A9Y1V1|A9Y1V1_HAELO Ribosomal protein P0 OS=Haemaphysalis longicornis PE=2 S Haemaphysalis 2 0.000 longicornis tr|A9XYV8|A9XYV8_MASGI Putative uncharacterized protein (Fragment) OS=Mastigopr Mastigoproctus giganteus 1 0.000 tr|B4YTU0|B4YTU0_9ACAR Heat shock protein 70-3 OS=Tetranychus cinnabarinus PE= Tetranychus cinnabarinus 1 0.000 sp|Q4PLZ3|TCTP_IXOSC Translationally-controlled tumor protein homolog OS=Ixodes Ixodes scapularis 1 0.000 tr|B7P1C8|B7P1C8_IXOSC Protein hu-li tai shao, putative OS=Ixodes scapularis GN Ixodes scapularis 1 0.000 tr|B7P1U0|B7P1U0_IXOSC GTP-specific succinyl-CoA synthetase, beta subunit, put Ixodes scapularis 1 0.000 tr|B7P201|B7P201_IXOSC Ran GTPase-activating protein, putative OS=Ixodes scapul Ixodes scapularis 1 0.000 tr|B7P2P8|B7P2P8_IXOSC ATP synthase alpha subunit vacuolar, putative (Fragment) Ixodes scapularis 1 0.000 tr|B7P2Q4|B7P2Q4_IXOSC Lamin, putative OS=Ixodes scapularis GN=IscW_ISCW000339 Ixodes scapularis 1 0.000 tr|B7P328|B7P328_IXOSC Superoxide dismutase (Fragment) OS=Ixodes scapularis GN Ixodes scapularis 1 0.000 tr|B7P361|B7P361_IXOSC 26S protease regulatory subunit 6B, putative OS=Ixodes s Ixodes scapularis 1 0.000 tr|B7P363|B7P363_IXOSC Ufm1-conjugating enzyme, putative OS=Ixodes scapularis Ixodes scapularis 1 0.000 tr|B7P3A9|B7P3A9_IXOSC Coatomer delta subunit, putative OS=Ixodes scapularis GN Ixodes scapularis 1 0.000 tr|B7P3G6|B7P3G6_IXOSC Medium-chain acyl-CoA dehydrogenase, putative OS=Ixodes Ixodes scapularis 1 0.000 tr|B7P3N4|B7P3N4_IXOSC Cytochrome P450, putative OS=Ixodes scapularis GN=IscW_I Ixodes scapularis 1 0.000 tr|B7P462|B7P462_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes sc Ixodes scapularis 1 0.000 tr|B7P4M6|B7P4M6_IXOSC Tyrosyl-tRNA synthetase, putative OS=Ixodes scapularis Ixodes scapularis 1 0.000 tr|B7P557|B7P557_IXOSC Mapmodulin, putative OS=Ixodes scapularis GN=IscW_ISCW00 Ixodes scapularis 1 0.000 tr|B7P5C4|B7P5C4_IXOSC Translation initiation factor 4F, helicase subunit, puta Ixodes scapularis 1 0.000 tr|B7P6A9|B7P6A9_IXOSC ATP synthase subunit beta OS=Ixodes scapularis GN=IscW_I Ixodes scapularis 1 0.000 tr|B7P6P0|B7P6P0_IXOSC Glycoprotein 25l, putative OS=Ixodes scapularis GN=IscW_ Ixodes scapularis 1 0.000 tr|B7P7P7|B7P7P7_IXOSC Apoptosis inhibitor, putative OS=Ixodes scapularis GN=I Ixodes scapularis 1 0.000 tr|B7P7U3|B7P7U3_IXOSC Chloride channel, putative OS=Ixodes scapularis GN=IscW Ixodes scapularis 1 0.000 tr|B7P839|B7P839_IXOSC DEK domain-containing protein, putative OS=Ixodes scapu Ixodes scapularis 1 0.000 tr|B7P9E4|B7P9E4_IXOSC Na+/K+ ATPase, alpha subunit, putative (Fragment) OS=Ixo Ixodes scapularis 1 0.000 tr|B7PB95|B7PB95_IXOSC Stathmin OS=Ixodes scapularis GN=IscW_ISCW003366 PE=3 S Ixodes scapularis 1 0.000 tr|B7PBJ3|B7PBJ3_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes sc Ixodes scapularis 1 0.000 tr|B7PDF5|B7PDF5_IXOSC Prolyl endopeptidase, putative OS=Ixodes scapularis GN=I Ixodes scapularis 1 0.000 tr|B7PEA9|B7PEA9_IXOSC 40S ribosomal protein, putative OS=Ixodes scapularis GN= Ixodes scapularis 1 0.000 tr|B7PEL0|B7PEL0_IXOSC Tetraspanin, putative OS=Ixodes scapularis GN=IscW_ISCW0 Ixodes scapularis 1 0.000 tr|B7PH43|B7PH43_IXOSC Alpha tubulin OS=Ixodes scapularis GN=IscW_ISCW003527 PE Ixodes scapularis 1 0.000 tr|B7PHG9|B7PHG9_IXOSC ATPase, putative OS=Ixodes scapularis GN=IscW_ISCW01829 Ixodes scapularis 1 0.000 tr|B7PHT2|B7PHT2_IXOSC Histone H2A OS=Ixodes scapularis GN=IscW_ISCW004478 PE= Ixodes scapularis 1 0.000 tr|B7PIN1|B7PIN1_IXOSC Heat shock protein 20.6, putative OS=Ixodes scapularis G Ixodes scapularis 1 0.000 tr|B7PJ70|B7PJ70_IXOSC Reticulon/nogo, putative OS=Ixodes scapularis GN=IscW_IS Ixodes scapularis 1 0.000 tr|B7PKH2|B7PKH2_IXOSC Mcm2/3, putative (Fragment) OS=Ixodes scapularis GN=Isc Ixodes scapularis 1 0.000 tr|B7PKL1|B7PKL1_IXOSC Neurofilament medium polypeptide, putative (Fragment) OS Ixodes scapularis 1 0.000 tr|B7PKP8|B7PKP8_IXOSC Spermidine synthase, putative OS=Ixodes scapularis GN=I Ixodes scapularis 1 0.000 tr|B7PL04|B7PL04_IXOSC Pyruvate decarboxylase (E-1) alpha subunit, putative (Fr Ixodes scapularis 1 0.000 tr|B7PL25|B7PL25_IXOSC Double-stranded RNA-specific editase B2, putative OS=Ix Ixodes scapularis 1 0.000 tr|B7PMC3|B7PMC3_IXOSC Putative uncharacterized protein OS=Ixodes scapularis GN Ixodes scapularis 1 0.000 tr|B7PNG4|B7PNG4_IXOSC Alpha tubulin, putative OS=Ixodes scapularis GN=IscW_ISC Ixodes scapularis 1 0.000 tr|B7PNN1|B7PNN1_IXOSC Proteasome subunit alpha type OS=Ixodes scapularis GN=Is Ixodes scapularis 1 0.000 tr|B7PPI3|B7PPI3_IXOSC Secreted protein, putative OS=Ixodes scapularis GN=IscW_ Ixodes scapularis 1 0.000 tr|B7PPL3|B7PPL3_IXOSC Microtubule-binding protein, putative OS=Ixodes scapular Ixodes scapularis 1 0.000 tr|B7PQP7|B7PQP7_IXOSC Hydroxyacyl-CoA dehydrogenase, putative (Fragment) OS=Ix Ixodes scapularis 1 0.000 tr|B7PR83|B7PR83_IXOSC Ubiquitin conjugating enzyme E1, putative OS=Ixodes scap Ixodes scapularis 1 0.000 tr|B7PT52|B7PT52_IXOSC Embryonic protein DC-8, putative OS=Ixodes scapularis GN Ixodes scapularis 1 0.000 tr|B7PVG5|B7PVG5_IXOSC GTP-binding protein, putative OS=Ixodes scapularis GN=Is Ixodes scapularis 1 0.000 tr|B7PVL8|B7PVL8_IXOSC Guanine nucleotide-binding protein G, putative (Fragment Ixodes scapularis 1 0.000 tr|B7PWM5|B7PWM5_IXOSC Alternative splicing factor SRp20/9G8, putative OS=Ixode Ixodes scapularis 1 0.000 tr|B7PWY6|B7PWY6_IXOSC Ubiquitin carboxyl-terminal hydrolase OS=Ixodes scapular Ixodes scapularis 1 0.000 tr|B7PZ24|B7PZ24_IXOSC Chaperonin complex component, TCP-1 delta subunit, putat Ixodes scapularis 1 0.000 tr|B7PZR4|B7PZR4_IXOSC Surfeit 4 protein, putative OS=Ixodes scapularis GN=IscW Ixodes scapularis 1 0.000 tr|B7Q0D6|B7Q0D6_IXOSC Phosphoserine aminotransferase, putative OS=Ixodes scapu Ixodes scapularis 1 0.000 tr|B7Q121|B7Q121_IXOSC Putative uncharacterized protein OS=Ixodes scapularis GN Ixodes scapularis 1 0.000 tr|B7Q1V4|B7Q1V4_IXOSC Galectin, putative OS=Ixodes scapularis GN=IscW_ISCW008 Ixodes scapularis 1 0.000 tr|B7Q2W2|B7Q2W2_IXOSC UTP-glucose-1-phosphate uridylyltransferase, putative (F Ixodes scapularis 1 0.000 tr|B7Q3I2|B7Q3I2_IXOSC Citrate synthase (Fragment) OS=Ixodes scapularis GN=IscW Ixodes scapularis 1 0.000 tr|B7Q5F6|B7Q5F6_IXOSC Proteasome subunit alpha type OS=Ixodes scapularis GN=Is Ixodes scapularis 1 0.000 tr|B7Q645|B7Q645_IXOSC Secreted salivary gland peptide, putative (Fragment) OS Ixodes scapularis 1 0.000 tr|B7Q6Z1|B7Q6Z1_IXOSC Saposin, putative OS=Ixodes scapularis GN=IscW_ISCW01159 Ixodes scapularis 1 0.000 tr|B7Q8U6|B7Q8U6_IXOSC Adenosine kinase, putative OS=Ixodes scapularis GN=IscW_ Ixodes scapularis 1 0.000 tr|B7QAP3|B7QAP3_IXOSC Dihydropteridine reductase, putative OS=Ixodes scapulari Ixodes scapularis 1 0.000 tr|B7QDB1|B7QDB1_IXOSC Ubiquitin carboxyl-terminal hydrolase (Fragment) OS=Ixo Ixodes scapularis 1 0.000 tr|B7QDV1|B7QDV1_IXOSC Histone, putative OS=Ixodes scapularis GN=IscW_ISCW01223 Ixodes scapularis 1 0.000 tr|B7QE67|B7QE67_IXOSC Proteasome subunit alpha type OS=Ixodes scapularis GN=Is Ixodes scapularis 1 0.000 tr|B7QF40|B7QF40_IXOSC Proteasome, subunit beta, putative OS=Ixodes scapularis Ixodes scapularis 1 0.000 tr|B7QFX7|B7QFX7_IXOSC RAB-9 and, putative OS=Ixodes scapularis GN=IscW_ISCW021 Ixodes scapularis 1 0.000 tr|B7QHA1|B7QHA1_IXOSC Ubiquitin carboxyl-terminal hydrolase isozyme L3, putat Ixodes scapularis 1 0.000 tr|B7QJ52|B7QJ52_IXOSC Transcriptional regulator DJ-1, putative OS=Ixodes scap Ixodes scapularis 1 0.000 tr|B7QJH6|B7QJH6_IXOSC Alpha-actinin, putative OS=Ixodes scapularis GN=IscW_ISC Ixodes scapularis 1 0.000 tr|B7QLE3|B7QLE3_IXOSC Protein kinase C substrate, 80 KD protein, heavy chain, Ixodes scapularis 1 0.000 tr|B7QNN4|B7QNN4_IXOSC Protein arginine N-methyltransferase PRMT1, putative OS= Ixodes scapularis 1 0.000 tr|Q4PM51|Q4PM51_IXOSC Translation initiation factor 5A (Fragment) OS=Ixodes sc Ixodes scapularis 1 0.000 tr|Q4VRW1|Q4VRW1_IXOSC Nucleotidase 4F8 OS=Ixodes scapularis PE=2 SV=1 Ixodes scapularis 1 0.000 tr|A6N9P0|A6N9P0_ORNPR 40S ribosomal protein S14 OS=Ornithodoros parkeri PE=2 S Ornithodoros parkeri 1 0.000 tr|B0LAI9|B0LAI9_9ACAR Glutathione S-transferase mu class OS=Rhipicephalus annu Rhipicephalus annulatus 1 0.000 tr|B2D2D4|B2D2D4_9ACAR Translation elongation factor EF-1 alpha/Tu (Fragment) Ornithodoros coriaceus 1 0.000 tr|B5M792|B5M792_9ACAR Heterogeneous nuclear ribonucleoprotein (Fragment) OS=Am Amblyomma americanum 1 0.000 tr|Q6X4W3|Q6X4W3_HAELO Actin OS=Haemaphysalis longicornis GN=Act1 PE=2 SV=1 Haemaphysalis longicornis 1 0.000 tr|Q86G66|Q86G66_DERVA Putative beta thymosin OS=Dermacentor variabilis PE=2 SV Dermacentor variabilis 1 0.000 tr|B7PC41|B7PC41_IXOSC Scavenger receptor class B type I, putative OS=Ixodes s Ixodes scapularis 1 0.002 tr|B7Q9Z3|B7Q9Z3_IXOSC Proteasome subunit alpha type (Fragment) OS=Ixodes scapu Ixodes scapularis 1 0.002 tr|B7Q634|B7Q634_IXOSC Cap binding protein, putative OS=Ixodes scapularis GN=I Ixodes scapularis 1 0.002 tr|B7PVI7|B7PVI7_IXOSC RNA-binding protein musashi, putative OS=Ixodes scapula Ixodes scapularis 3 0.002 tr|B7P625|B7P625_IXOSC Prohibitin, putative OS=Ixodes scapularis GN=IscW_ISCW00 Ixodes scapularis 2 0.002 tr|B7P950|B7P950_IXOSC DNA-binding protein, putative OS=Ixodes scapularis GN=I Ixodes scapularis 2 0.002 tr|B7QMM1|B7QMM1_IXOSC Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA l Ixodes scapularis 1 0.002 tr|B7QIG3|B7QIG3_IXOSC Electron transfer flavoprotein, alpha subunit, putative Ixodes scapularis 4 0.002 tr|B4YTT8|B4YTT8_9ACAR Heat shock protein 70-1 OS=Tetranychus cinnabarinus PE=2 Tetranychus cinnabarinus 3 0.002 tr|Q4PM16|Q4PM16_IXOSC 60S ribosomal protein L23 OS=Ixodes scapularis PE=2 SV= Ixodes scapularis 1 0.002 tr|B7Q505|B7Q505_IXOSC Elongation factor Tu OS=Ixodes scapularis GN=IscW_ISCW0 Ixodes scapularis 3 0.002 tr|A6NA07|A6NA07_ORNPR 60S ribosomal protein L9 OS=Ornithodoros parkeri PE=2 S Ornithodoros parkeri 1 0.002 tr|B7QH63|B7QH63_IXOSC Putative uncharacterized protein OS=Ixodes scapularis G Ixodes scapularis 1 0.002 tr|B7QIL1|B7QIL1_IXOSC FERM, RhoGEF and pleckstrin domain-containing protein, Ixodes scapularis 1 0.002 tr|B7Q0K8|B7Q0K8_IXOSC Ribosome biogenesis protein-Nop58p/Nop5p, putative OS=I Ixodes scapularis 2 0.002 tr|B7PJP9|B7PJP9_IXOSC Enolase OS=Ixodes scapularis GN=IscW_ISCW017666 PE=3 SV= Ixodes scapularis 1 0.002 tr|A7BFI9|A7BFI9_HAELO Valosin containing protein OS=Haemaphysalis longicornis Haemaphysalis longicornis 3 0.002 tr|B7P0P1|B7P0P1_IXOSC DNA topoisomerase 2 OS=Ixodes scapularis GN=IscW_ISCW01 Ixodes scapularis 2 0.002 tr|B7QGH7|B7QGH7_IXOSC Ataxin-10, putative OS=Ixodes scapularis GN=IscW_ISCW022 Ixodes scapularis 1 0.002 tr|B7Q0R0|B7Q0R0_IXOSC Phosphoglycerate mutase, putative OS=Ixodes scapularis G Ixodes scapularis 1 0.002 tr|B7PZP2|B7PZP2_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes s Ixodes scapularis 2 0.002 tr|B7PXG2|B7PXG2_IXOSC Glycoprotein gC1qBP, putative OS=Ixodes scapularis GN=I Ixodes scapularis 1 0.002 tr|B7QF39|B7QF39_IXOSC Transcription factor Mbf1, putative OS=Ixodes scapulari Ixodes scapularis 2 0.002 tr|B7Q5K4|B7Q5K4_IXOSC Radixin, moesin, putative OS=Ixodes scapularis GN=IscW_ Ixodes scapularis 1 0.002 tr|B7P7A5|B7P7A5_IXOSC Ribophorin, putative (Fragment) OS=Ixodes scapularis GN= Ixodes scapularis 3 0.002 tr|A1DZP1|A1DZP1_9ACAR Elongation factor 1alpha (Fragment) OS=Rhysotritia dupli Rhysotritia duplicata 1 0.002 tr|B7Q6G7|B7Q6G7_IXOSC Flavonol reductase/cinnamoyl-CoA reductase, putative (F Ixodes scapularis 3 0.002 tr|B7PSK1|B7PSK1_IXOSC Vacuolar sorting protein VPS28, putative OS=Ixodes scapu Ixodes scapularis 1 0.002 tr|B7PDE1|B7PDE1_IXOSC 26S proteasome non-ATPase regulatory subunit, putative Ixodes scapularis 1 0.002 tr|A0SHR2|A0SHR2_AMBVA Protein disulfide isomerase OS=Amblyomma variegatum PE=2 Amblyomma variegatum 3 0.002 tr|B7PJY6|B7PJY6_IXOSC Flavonol reductase/cinnamoyl-CoA reductase, putative OS= Ixodes scapularis 2 0.003 tr|B7Q6N4|B7Q6N4_IXOSC Proteasome subunit alpha type, putative OS=Ixodes scapul Ixodes scapularis 2 0.003 tr|B7Q2P8|B7Q2P8_IXOSC 16 kDa thioredoxion, putative OS=Ixodes scapularis GN=I Ixodes scapularis 3 0.003 tr|B7Q0Q1|B7Q0Q1_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes sc Ixodes scapularis 1 0.003 tr|Q4PLZ7|Q4PLZ7_IXOSC Signal peptidase, putative OS=Ixodes scapularis GN=IscW Ixodes scapularis 1 0.003 tr|B7PCD2|B7PCD2_IXOSC NADP-dependent isocitrate dehydrogenase, putative OS=Ixo Ixodes scapularis 1 0.003 tr|B7P585|B7P585_IXOSC Phosphoglycerate kinase OS=Ixodes scapularis GN=IscW_ISC Ixodes scapularis 2 0.003 tr|B7P595|B7P595_IXOSC Proline and glutamine-rich splicing factor (SFPQ), puta Ixodes scapularis 2 0.003 tr|B7PE36|B7PE36_IXOSC Nucleosome assembly protein NAP-1, putative (Fragment) Ixodes scapularis 1 0.003 tr|B7QN17|B7QN17_IXOSC Thioredoxin-dependent peroxide reductase OS=Ixodes scapu Ixodes scapularis 2 0.003 tr|B7Q1W5|B7Q1W5_IXOSC Elongation factor 1 gamma, putative OS=Ixodes scapulari Ixodes scapularis 1 0.003 tr|A6N9Z4|A6N9Z4_ORNPR 40S ribosomal protein S3 OS=Ornithodoros parkeri PE=2 SV Ornithodoros parkeri 2 0.003 tr|A8UY20|A8UY20_9ACAR Elongation factor 1-alpha (Fragment) OS=Hypochthonius l Hypochthonius luteus 2 0.003 tr|B7QAW9|B7QAW9_IXOSC ATP synthase B chain, putative OS=Ixodes scapularis GN= Ixodes scapularis 1 0.003 tr|B7PUS2|B7PUS2_IXOSC Ribosome recycling factor, putative OS=Ixodes scapulari Ixodes scapularis 1 0.003 tr|A9QQC2|A9QQC2_LYCSI Cofilin OS=Lycosa singoriensis PE=2 SV=1 Lycosa singoriensis 1 0.003 tr|B7PEL3|B7PEL3_IXOSC Protein tyrosine phosphatase, putative OS=Ixodes scapula Ixodes scapularis 1 0.003 tr|B7P2S4|B7P2S4_IXOSC Acetyl-CoA acetyltransferase, putative (Fragment) OS=Ix Ixodes scapularis 1 0.003 tr|B7PR84|B7PR84_IXOSC Ubiquitin-activating enzyme E1, putative (Fragment) OS= Ixodes scapularis 4 0.003 tr|B7QIX6|B7QIX6_IXOSC Kinesin, putative OS=Ixodes scapularis GN=IscW_ISCW01433 Ixodes scapularis 1 0.003 tr|B7PC82|B7PC82_IXOSC Thimet oligopeptidase, putative OS=Ixodes scapularis GN Ixodes scapularis 1 0.003 tr|B7QI53|B7QI53_IXOSC Apoptosis-promoting RNA-binding protein TIA-1/TIAR, put Ixodes scapularis 3 0.003 tr|B2ZWT4|B2ZWT4_HAELO Peptidyl-prolyl cis-trans isomerase OS=Haemaphysalis lo Haemaphysalis longicornis 1 0.003 sp|Q09JT4|RL38_ARGMO 60S ribosomal protein L38 OS=Argas monolakensis GN=RpL38 Argas monolakensis 1 0.003 tr|B7QDB3|B7QDB3_IXOSC Ribosomal protein S27 OS=Ixodes scapularis GN=IscW_ISCW Ixodes scapularis 1 0.003 tr|B7PS62|B7PS62_IXOSC 26S proteasome regulatory complex, subunit RPN10/PSMD4, Ixodes scapularis 1 0.003 tr|B7P2W2|B7P2W2_IXOSC 60S ribosomal protein L14, putative OS=Ixodes scapularis Ixodes scapularis 1 0.003 tr|B7QIP4|B7QIP4_IXOSC 4SNc-Tudor domain protein, putative OS=Ixodes scapularis Ixodes scapularis 3 0.003 tr|Q4PLY7|Q4PLY7_IXOSC Nucleoside diphosphate kinase (Fragment) OS=Ixodes scapu Ixodes scapularis 2 0.003 tr|B7P289|B7P289_IXOSC Prolyl 4-hydroxylase alpha subunit, putative OS=Ixodes s Ixodes scapularis 1 0.003 sp|A6NA00|RSSA_ORNPR 40S ribosomal protein SA OS=Ornithodoros parkeri PE=2 SV= Ornithodoros parkeri 2 0.003 tr|B7PQS1|B7PQS1_IXOSC Phenylalanyl-tRNA synthetase beta subunit, putative OS= Ixodes scapularis 1 0.003 tr|B7PGC4|B7PGC4_IXOSC Uridine 5'-monophosphate synthase, putative OS=Ixodes sc Ixodes scapularis 1 0.003 tr|B7PEK1|B7PEK1_IXOSC Polypyrimidine tract binding protein, putative (Fragmen Ixodes scapularis 1 0.003 tr|B7Q1Y2|B7Q1Y2_IXOSC 6-phosphogluconate dehydrogenase, decarboxylating (Frag Ixodes scapularis 2 0.003 tr|Q64K74|Q64K74_IXOSC Calreticulin OS=Ixodes scapularis PE=3 SV=1 Ixodes scapularis 1 0.003 tr|B7PA03|B7PA03_IXOSC ATP-dependent helicase (DEAD box), putative OS=Ixodes s Ixodes scapularis 1 0.003 tr|B7PD56|B7PD56_IXOSC Peptidyl-prolyl cis-trans isomerase OS=Ixodes scapularis Ixodes scapularis 3 0.003 tr|B7PZG8|B7PZG8_IXOSC Aldehyde dehydrogenase, putative OS=Ixodes scapularis GN Ixodes scapularis 2 0.003 tr|A6N9N9|A6N9N9_ORNPR Ribosomal protein S7 OS=Ornithodoros parkeri PE=2 SV=1 Ornithodoros parkeri 1 0.003 tr|B7PGX4|B7PGX4_IXOSC Synaptic vesicle-associated integral membrane protein, Ixodes scapularis 1 0.004 tr|B7Q331|B7Q331_IXOSC Glucose-6-phosphate 1-dehydrogenase (Fragment) OS=Ixode Ixodes scapularis 1 0.004 tr|B7P5W3|B7P5W3_IXOSC Acyl-CoA synthetase, putative OS=Ixodes scapularis GN=I Ixodes scapularis 1 0.004 tr|B7PQP6|B7PQP6_IXOSC Acetyl-CoA acetyltransferase, putative (Fragment) OS=Ix Ixodes scapularis 1 0.004 tr|B7PTQ4|B7PTQ4_IXOSC ADP ribosylation factor 79F, putative OS=Ixodes scapular Ixodes scapularis 1 0.004 tr|B7Q5H9|B7Q5H9_IXOSC Fructose-bisphosphate aldolase OS=Ixodes scapularis GN=I Ixodes scapularis 2 0.004 tr|B5M728|B5M728_9ACAR Translocon-associated protein subunit alpha OS=Amblyomma Amblyomma americanum 1 0.004 tr|B7PSQ6|B7PSQ6_IXOSC 40S ribosomal protein S3A, putative OS=Ixodes scapularis Ixodes scapularis 1 0.004 tr|B7Q396|B7Q396_IXOSC Secreted protein, putative OS=Ixodes scapularis GN=IscW Ixodes scapularis 1 0.004 tr|B7Q4L8|B7Q4L8_IXOSC Ribosomal protein, putative (Fragment) OS=Ixodes scapul Ixodes scapularis 1 0.004 tr|B7QCB3|B7QCB3_IXOSC Cytochrome B5, putative OS=Ixodes scapularis GN=IscW_IS Ixodes scapularis 1 0.004 tr|B7Q2P2|B7Q2P2_IXOSC Zinc finger protein, putative (Fragment) OS=Ixodes scapu Ixodes scapularis 1 0.004 tr|B7P2T4|B7P2T4_IXOSC Ribosomal protein S17, putative OS=Ixodes scapularis GN Ixodes scapularis 1 0.004 tr|B7Q9E5|B7Q9E5_IXOSC Alpha-2-macroglobulin receptor-associated protein, puta Ixodes scapularis 1 0.004 tr|B7P5B3|B7P5B3_IXOSC U5 snRNP-specific protein, putative (Fragment) OS=Ixode Ixodes scapularis 1 0.004 tr|B7PJP4|B7PJP4_IXOSC Dolichyl-di-phosphooligosaccharide protein glycotransfe Ixodes scapularis 1 0.004 tr|B7P7F7|B7P7F7_IXOSC Heat shock protein, putative OS=Ixodes scapularis GN=Isc Ixodes scapularis 1 0.004 tr|B7Q0B3|B7Q0B3_IXOSC Heat shock protein 70 (HSP70)-interacting protein, puta Ixodes scapularis 1 0.004 tr|B7PNL5|B7PNL5_IXOSC Syntenin, putative OS=Ixodes scapularis GN=IscW_ISCW0057 Ixodes scapularis 1 0.004 tr|B7P5Y0|B7P5Y0_IXOSC Seryl-tRNA synthetase, putative OS=Ixodes scapularis GN Ixodes scapularis 1 0.004 tr|B7PXR5|B7PXR5_IXOSC Chaperonin complex component, TCP-1 eta subunit, putativ Ixodes scapularis 1 0.004 tr|B7PPR5|B7PPR5_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes sc Ixodes scapularis 1 0.004 tr|B7PCN1|B7PCN1_IXOSC Aldo-keto reductase, putative OS=Ixodes scapularis GN=Is Ixodes scapularis 2 0.004 tr|B6V3B5|B6V3B5_IXORI Glutathione peroxidase OS=Ixodes ricinus PE=2 SV=1 Ixodes ricinus 2 0.004 tr|B7QNR8|B7QNR8_IXOSC Importin beta, nuclear transport factor, putative OS=Ix Ixodes scapularis 2 0.004 tr|B7P573|B7P573_IXOSC Processing peptidase beta subunit, putative OS=Ixodes sc Ixodes scapularis 3 0.006 tr|B7P7M2|B7P7M2_IXOSC Signal recognition particle protein, putative OS=Ixodes Ixodes scapularis 2 0.006 tr|B7PNN7|B7PNN7_IXOSC Attractin and platelet-activating factor acetylhydrolase Ixodes scapularis 1 0.006 tr|B7Q4F2|B7Q4F2_IXOSC Cop9 complex subunit 7A, putative OS=Ixodes scapularis Ixodes scapularis 1 0.008 tr|B7PAS1|B7PAS1_IXOSC MCM2 protein, putative (Fragment) OS=Ixodes scapularis Ixodes scapularis 1 0.008 tr|B7PCK4|B7PCK4_IXOSC Splicing factor u2af large subunit, putative OS=Ixodes Ixodes scapularis 1 0.008 tr|B7QEF1|B7QEF1_IXOSC VAMP-associated protein involved in inositol metabolism Ixodes scapularis 1 0.008 tr|B7Q5L0|B7Q5L0_IXOSC ATP synthase OS=Ixodes scapularis GN=IscW_ISCW021200 PE Ixodes scapularis 1 0.008 tr|B7PQA7|B7PQA7_IXOSC Secreted protein, putative OS=Ixodes scapularis GN=IscW Ixodes scapularis 1 0.008 tr|A8UYT9|A8UYT9_9ACAR Elongation factor 1-alpha (Fragment) OS=Schoutedenocopt Schoutedenocoptes aquilae 1 0.008 tr|A8UY35|A8UY35_9ACAR Elongation factor 1-alpha (Fragment) OS=Hormosianoetus m Hormosianoetus mallotae 1 0.008 tr|B7PN29|B7PN29_IXOSC Steroid membrane receptor Hpr6.6/25-Dx, putative OS=Ixo Ixodes scapularis 2 0.008 tr|B7QAM9|B7QAM9_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes s Ixodes scapularis 1 0.008 tr|B7PQ08|B7PQ08_IXOSC U1 small nuclear ribonucleoprotein A, putative OS=Ixode Ixodes scapularis 1 0.008 tr|A9QQ29|A9QQ29_LYCSI Translation elongation factor 2 (Fragment) OS=Lycosa sin Lycosa singoriensis 1 0.008 tr|B7PYP5|B7PYP5_IXOSC Heat shock protein, putative OS=Ixodes scapularis GN=Is Ixodes scapularis 1 0.008 tr|B7Q3T6|B7Q3T6_IXOSC THO complex subunit, putative OS=Ixodes scapularis GN=Is Ixodes scapularis 1 0.009 tr|B7QC21|B7QC21_IXOSC Annexin V, putative (Fragment) OS=Ixodes scapularis GN= Ixodes scapularis 2 0.009 tr|B7PSB7|B7PSB7_IXOSC Activator of 90 kDa heat shock protein ATPase, putative Ixodes scapularis 1 0.010 tr|B7QLI8|B7QLI8_IXOSC Tyrosine aminotransferase, putative (Fragment) OS=Ixodes Ixodes scapularis 1 0.010 tr|Q4PM83|Q4PM83_IXOSC Ribosomal protein L27A, putative OS=Ixodes scapularis G Ixodes scapularis 1 0.010 tr|B7PV22|B7PV22_IXOSC Poly [ADP-ribose] polymerase, putative OS=Ixodes scapul Ixodes scapularis 1 0.010 tr|B7PHM9|B7PHM9_IXOSC Isocitrate dehydrogenase, putative (Fragment) OS=Ixodes Ixodes scapularis 1 0.010 tr|A9QQ53|A9QQ53_LYCSI 60S ribosomal protein L13 (Fragment) OS=Lycosa singorie Lycosa singoriensis 1 0.010 Proteins identified with 1% < FDR < 5% tr|B7QCA7|B7QCA7_IXOSC Glucosidase II, putative (Fragment) OS=Ixodes scapulari Ixodes scapularis 1 0.010 tr|B7PR58|B7PR58_IXOSC GTP binding protein Rab-1A OS=Ixodes scapularis GN=IscW Ixodes scapularis 2 0.010 tr|B7QCB8|B7QCB8_IXOSC 26S proteasome regulatory subunit 7, psd7, putative (Fr Ixodes scapularis 1 0.010 tr|A9QQ67|A9QQ67_LYCSI 40S ribosomal protein S3a OS=Lycosa singoriensis PE=2 S Lycosa singoriensis 2 0.010 tr|B7Q760|B7Q760_IXOSC Nucleotide excision repair factor NEF2, RAD23 component Ixodes scapularis 2 0.010 tr|B7PRH5|B7PRH5_IXOSC T-complex protein 1, delta subunit OS=Ixodes scapularis Ixodes scapularis 1 0.010 tr|B7P971|B7P971_IXOSC Calponin, putative OS=Ixodes scapularis GN=IscW_ISCW0030 Ixodes scapularis 1 0.010 tr|B7PTK1|B7PTK1_IXOSC Multiple ankyrin repeats single kh domain protein, puta Ixodes scapularis 1 0.010 tr|B7PIP9|B7PIP9_IXOSC Ankyrin 2,3/unc44, putative OS=Ixodes scapularis GN=IscW Ixodes scapularis 2 0.010 tr|B7PKZ9|B7PKZ9_IXOSC BRI1-KD interacting protein, putative OS=Ixodes scapula Ixodes scapularis 1 0.010 tr|B7Q362|B7Q362_IXOSC Eukaryotic translation initiation factor 4 gamma, putat Ixodes scapularis 1 0.011 tr|B7P6L7|B7P6L7_IXOSC 26S proteasome regulatory complex, subunit PSMD5, putat Ixodes scapularis 1 0.011 tr|B7PU84|B7PU84_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes s Ixodes scapularis 1 0.011 tr|B7PD93|B7PD93_IXOSC Ran-binding protein, putative OS=Ixodes scapularis GN=I Ixodes scapularis 1 0.011 tr|B7QMM9|B7QMM9_IXOSC Polyadenylate-binding protein-interacting protein, puta Ixodes scapularis 1 0.011 tr|B7P9A9|B7P9A9_IXOSC HyFMR1 protein, putative (Fragment) OS=Ixodes scapulari Ixodes scapularis 1 0.011 tr|B7PAK1|B7PAK1_IXOSC Integrin beta (Fragment) OS=Ixodes scapularis GN=IscW_I Ixodes scapularis 1 0.011 tr|B7PAI0|B7PAI0_IXOSC Ribosomal protein L28, putative OS=Ixodes scapularis GN= Ixodes scapularis 1 0.011 tr|B7P230|B7P230_IXOSC Translation initiation factor 2C, putative OS=Ixodes sc Ixodes scapularis 1 0.011 tr|A8E4J9|A8E4J9_9ACAR Calreticulin OS=Haemaphysalis qinghaiensis PE=2 SV=1 Haemaphysalis qinghaiensis 1 0.011 tr|B7PM02|B7PM02_IXOSC Proteasome beta2 subunit, putative OS=Ixodes scapularis Ixodes scapularis 1 0.012 tr|A6N9M1|A6N9M1_ORNPR 40S ribosomal protein S2/30S OS=Ornithodoros parkeri PE= Ornithodoros parkeri 2 0.013 tr|Q4PM69|Q4PM69_IXOSC Histone H4 OS=Ixodes scapularis GN=IscW_ISCW019498 PE=3 Ixodes scapularis 2 0.013 tr|B7Q3Z3|B7Q3Z3_IXOSC 26S proteasome regulatory subunit rpn1, putative OS=Ixo Ixodes scapularis 2 0.014 tr|B7Q7H2|B7Q7H2_IXOSC Kinesin light chain, putative OS=Ixodes scapularis GN=I Ixodes scapularis 1 0.014 tr|B7PXJ6|B7PXJ6_IXOSC Glyoxylate/hydroxypyruvate reductase, putative (Fragmen Ixodes scapularis 2 0.014 tr|B7PUB0|B7PUB0_IXOSC Secreted protein, putative OS=Ixodes scapularis GN=IscW Ixodes scapularis 1 0.016 tr|B7PJZ9|B7PJZ9_IXOSC Dynein light chain OS=Ixodes scapularis GN=IscW_ISCW003 Ixodes scapularis 1 0.017 tr|B7P377|B7P377_IXOSC Lim and sh3 domain protein 1, lasp-1, putative OS=Ixode Ixodes scapularis 1 0.017 tr|B7Q310|B7Q310_IXOSC Putative uncharacterized protein OS=Ixodes scapularis G Ixodes scapularis 1 0.017 tr|B7P8J4|B7P8J4_IXOSC ATP-dependent RNA helicase, putative (Fragment) OS=Ixode Ixodes scapularis 1 0.017 tr|B7PAG0|B7PAG0_IXOSC THO complex subunit, putative OS=Ixodes scapularis GN=I Ixodes scapularis 1 0.017 tr|B7PXG9|B7PXG9_IXOSC Glutathione S-transferase, putative OS=Ixodes scapulari Ixodes scapularis 1 0.017 tr|B7PKQ6|B7PKQ6_IXOSC Cell division protein, putative (Fragment) OS=Ixodes sca Ixodes scapularis 1 0.017 tr|B7PVP6|B7PVP6_IXOSC Rho/RAC guanine nucleotide exchange factor, putative OS= Ixodes scapularis 1 0.017 tr|B0LUH3|B0LUH3_IXORI Thioredoxin peroxidase OS=Ixodes ricinus PE=2 SV=1 Ixodes ricinus 1 0.017 tr|B2YGD3|B2YGD3_9ARAC Actin (Fragment) OS=Galianora bryicola PE=4 SV=1 Galianora bryicola 1 0.017 tr|B7QFT9|B7QFT9_IXOSC Lectin, putative OS=Ixodes scapularis GN=IscW_ISCW01262 Ixodes scapularis 1 0.017 tr|B7PR90|B7PR90_IXOSC Ribosomal protein L13A, putative OS=Ixodes scapularis GN Ixodes scapularis 1 0.017 tr|B7QL56|B7QL56_IXOSC DNA replication licensing factor, putative (Fragment) O Ixodes scapularis 1 0.017 tr|B7Q4R6|B7Q4R6_IXOSC Ku P70 DNA helicase, putative (Fragment) OS=Ixodes scap Ixodes scapularis 1 0.017 tr|B7PKK7|B7PKK7_IXOSC Ubiquitin carrier protein OS=Ixodes scapularis GN=IscW_ Ixodes scapularis 1 0.018 tr|B7PCH9|B7PCH9_IXOSC Histidine triad nucleotide binding protein, putative (F Ixodes scapularis 1 0.018 tr|B7PT80|B7PT80_IXOSC Spindle pole body protein, putative OS=Ixodes scapulari Ixodes scapularis 1 0.019 tr|B7QF74|B7QF74_IXOSC Microsomal glutathione S-transferase, putative OS=Ixode Ixodes scapularis 1 0.019 tr|B7QMF1|B7QMF1_IXOSC Reductase, putative (Fragment) OS=Ixodes scapularis GN=I Ixodes scapularis 1 0.019 tr|B7P555|B7P555_IXOSC Coronin, putative (Fragment) OS=Ixodes scapularis GN=Is Ixodes scapularis 1 0.019 tr|B7P1Y7|B7P1Y7_IXOSC Transcription factor S-II, putative OS=Ixodes scapulari Ixodes scapularis 1 0.019 tr|B7QF45|B7QF45_IXOSC 3-keto-acyl-CoA thiolase, putative OS=Ixodes scapularis Ixodes scapularis 1 0.019 tr|B7PGP8|B7PGP8_IXOSC Replication factor C, subunit RFC3, putative OS=Ixodes s Ixodes scapularis 1 0.019 tr|B7PWX1|B7PWX1_IXOSC Phospholipase A-2-activating protein, putative (Fragment Ixodes scapularis 1 0.020 tr|B7Q0N5|B7Q0N5_IXOSC Heat shock protein 70 (HSP70)-interacting protein, puta Ixodes scapularis 1 0.020 tr|B7Q0E8|B7Q0E8_IXOSC Serpin 7, putative OS=Ixodes scapularis GN=IscW_ISCW009 Ixodes scapularis 1 0.020 tr|B7QDS2|B7QDS2_IXOSC Matricellular protein osteonectin/SPARC/BM-40, putative Ixodes scapularis 2 0.021 tr|B7P367|B7P367_IXOSC Putative uncharacterized protein OS=Ixodes scapularis GN Ixodes scapularis 1 0.021 tr|B7P3D3|B7P3D3_IXOSC FKBP-type peptidyl-prolyl cis-trans isomerase, putative Ixodes scapularis 1 0.021 tr|B7QD48|B7QD48_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes sc Ixodes scapularis 1 0.021 tr|B7PIZ2|B7PIZ2_IXOSC ADP-ribosylation factor, putative (Fragment) OS=Ixodes Ixodes scapularis 1 0.022 tr|B7PCU5|B7PCU5_IXOSC 2-oxoglutarate dehydrogenase, putative OS=Ixodes scapul Ixodes scapularis 1 0.023 tr|A6N9M5|A6N9M5_ORNPR 40S ribosomal protein S20 OS=Ornithodoros parkeri PE=2 Ornithodoros parkeri 1 0.023 tr|B7PVQ8|B7PVQ8_IXOSC Putative uncharacterized protein OS=Ixodes scapularis G Ixodes scapularis 1 0.023 tr|B7Q347|B7Q347_IXOSC Putative uncharacterized protein OS=Ixodes scapularis G Ixodes scapularis 1 0.024 tr|B7PSJ2|B7PSJ2_IXOSC Proteasome subunit alpha type OS=Ixodes scapularis GN=I Ixodes scapularis 1 0.024 tr|A5HLD6|A5HLD6_9ARAC Heat shock protein 70kDa (Fragment) OS=Diguetia mojavea Diguetia mojavea 1 0.024 tr|B5M794|B5M794_9ACAR Damaged-DNA binding protein DDB p127 subunit (Fragment) Amblyomma americanum 1 0.025 tr|B7PRG2|B7PRG2_IXOSC 60S acidic ribosomal protein P0, putative OS=Ixodes sca Ixodes scapularis 1 0.025 tr|B5M799|B5M799_9ACAR Histone H2B OS=Amblyomma americanum PE=2 SV=1 Amblyomma americanum 1 0.025 tr|B7PFQ0|B7PFQ0_IXOSC 60S ribosomal protein L27, putative OS=Ixodes scapulari Ixodes scapularis 1 0.025 tr|B7PHX7|B7PHX7_IXOSC Adenylate kinase, putative OS=Ixodes scapularis GN=IscW Ixodes scapularis 1 0.026 tr|A9P773|A9P773_BOOMI Glycogen synthase kinase OS=Boophilus microplus GN=GSK-3 Boophilus microplus 1 0.026 tr|B7PU34|B7PU34_IXOSC P2X purinoceptor,putative OS=Ixodes scapularis GN=IscW_ Ixodes scapularis 1 0.026 tr|B7PVV2|B7PVV2_IXOSC Procollagen-lysine, 2-oxoglutarate 5-dioxygenase, putat Ixodes scapularis 1 0.026 sp|Q4PMB3|RS4_IXOSC 40S ribosomal protein S4 OS=Ixodes scapularis GN=RpS4 PE=2 Ixodes scapularis 1 0.027 tr|B7PIV8|B7PIV8_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes s Ixodes scapularis 1 0.027 tr|B7PZ79|B7PZ79_IXOSC Proteasome subunit alpha type, putative OS=Ixodes scapu Ixodes scapularis 1 0.027 tr|B7Q650|B7Q650_IXOSC Reductase, putative (Fragment) OS=Ixodes scapularis GN= Ixodes scapularis 1 0.027 tr|B7QCU0|B7QCU0_IXOSC CDK inhibitor P21 binding protein, putative OS=Ixodes s Ixodes scapularis 1 0.031 tr|B7QLS5|B7QLS5_IXOSC Numb-associated kinase, putative OS=Ixodes scapularis G Ixodes scapularis 1 0.033 tr|B7P9Y8|B7P9Y8_IXOSC Protocadherin-16, putative OS=Ixodes scapularis GN=IscW Ixodes scapularis 1 0.033 tr|B7Q2Z7|B7Q2Z7_IXOSC Ribosomal protein S28, putative (Fragment) OS=Ixodes sc Ixodes scapularis 1 0.035 tr|B7PAM5|B7PAM5_IXOSC Peptidyl-prolyl cis-trans isomerase, putative OS=Ixodes Ixodes scapularis 1 0.036 tr|B7PKB9|B7PKB9_IXOSC Lumican, putative (Fragment) OS=Ixodes scapularis GN=Is Ixodes scapularis 1 0.036 tr|B7P9W6|B7P9W6_IXOSC 26S proteasome regulatory complex, subunit RPN5/PSMD12, Ixodes scapularis 1 0.040 tr|B7QF31|B7QF31_IXOSC Caspase, apoptotic cysteine protease, putative (Fragment Ixodes scapularis 1 0.041 tr|Q4PMB6|Q4PMB6_IXOSC 60S ribosomal protein L7a OS=Ixodes scapularis PE=2 SV= Ixodes scapularis 1 0.042 tr|B7Q1G1|B7Q1G1_IXOSC Methylmalonyl coenzyme A mutase, putative OS=Ixodes sca Ixodes scapularis 1 0.045 tr|B7QL45|B7QL45_IXOSC La/SS-B, putative (Fragment) OS=Ixodes scapularis GN=Is Ixodes scapularis 2 0.046 tr|B7Q0T6|B7Q0T6_IXOSC Acetylcholinesterase, putative OS=Ixodes scapularis GN= Ixodes scapularis 1 0.047 tr|B7PXM3|B7PXM3_IXOSC Putative uncharacterized protein OS=Ixodes scapularis G Ixodes scapularis 1 0.047 tr|B7PXA7|B7PXA7_IXOSC Golgi reassembly stacking protein, putative OS=Ixodes s Ixodes scapularis 1 0.048 tr|B7QIF6|B7QIF6_IXOSC Golgi protein, putative (Fragment) OS=Ixodes scapularis Ixodes scapularis 1 0.049 Proteins identified with 5% < FDR < 10% tr|B7QDQ3|B7QDQ3_IXOSC Molecular chaperone, putative OS=Ixodes scapularis GN=I Ixodes scapularis 1 0.050 tr|B7QAM6|B7QAM6_IXOSC Protein disulfide isomerase, putative (Fragment) OS=Ixo Ixodes scapularis 1 0.051 tr|B7QJ34|B7QJ34_IXOSC OTU domain, ubiquitin aldehyde binding protein, putativ Ixodes scapularis 1 0.051 tr|B7Q1W9|B7Q1W9_IXOSC Dihydrolipoamide acetyltransferase, putative (Fragment) Ixodes scapularis 1 0.052 tr|B7P2P0|B7P2P0_IXOSC Membrane protein, putative OS=Ixodes scapularis GN=IscW Ixodes scapularis 1 0.052 tr|B7Q792|B7Q792_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes s Ixodes scapularis 1 0.054 tr|B7PV46|B7PV46_IXOSC Putative uncharacterized protein OS=Ixodes scapularis G Ixodes scapularis 1 0.054 tr|Q6W976|Q6W976_9ARAC Sodium/potassium ATPase alpha subunit (Fragment) OS=Opi Opiliones sp. 1 0.054 tr|B7PSW5|B7PSW5_IXOSC Programmed cell death 6-interacting protein, putative O Ixodes scapularis 1 0.056 tr|B7Q6Y7|B7Q6Y7_IXOSC RNA-binding protein musashi, putative OS=Ixodes scapula Ixodes scapularis 1 0.056 tr|B7PGQ2|B7PGQ2_IXOSC Calnexin, putative OS=Ixodes scapularis GN=IscW_ISCW003 Ixodes scapularis 1 0.056 tr|B7P924|B7P924_IXOSC Rap1 GTPase-GDP dissociation stimulator, putative OS=Ix Ixodes scapularis 1 0.059 tr|B7Q5F9|B7Q5F9_IXOSC Glyoxalase, putative OS=Ixodes scapularis GN=IscW_ISCW0 Ixodes scapularis 1 0.059 tr|B7PAD5|B7PAD5_IXOSC Microtubule-binding protein, putative (Fragment) OS=Ixo Ixodes scapularis 1 0.059 tr|B7PYD1|B7PYD1_IXOSC ATP-dependent RNA helicase, putative (Fragment) OS=Ixod Ixodes scapularis 1 0.059 tr|B7Q3D3|B7Q3D3_IXOSC ATP-citrate synthase, putative OS=Ixodes scapularis GN=I Ixodes scapularis 1 0.059 tr|B7P163|B7P163_IXOSC Eukaryotic translation initiation factor 3 subunit C, p Ixodes scapularis 1 0.060 tr|B7PXW1|B7PXW1_IXOSC Ribosomal protein S25, putative (Fragment) OS=Ixodes sc Ixodes scapularis 1 0.063 tr|B7PT39|B7PT39_IXOSC Putative uncharacterized protein (Fragment) OS=Ixodes s Ixodes scapularis 1 0.063 tr|B7PYR8|B7PYR8_IXOSC Putative uncharacterized protein OS=Ixodes scapularis G Ixodes scapularis 1 0.063 tr|B7QMC8|B7QMC8_IXOSC Alpha-macroglobulin, putative (Fragment) OS=Ixodes scap Ixodes scapularis 1 0.063 tr|B5TMF7|B5TMF7_DERVA Glyceraldehyde 3-phosphate dehydrogenase OS=Dermacentor Dermacentor variabilis 1 0.063 tr|B7QLA4|B7QLA4_IXOSC Phosphatidylethanolamine-binding protein, putative OS=I Ixodes scapularis 1 0.066 tr|Q4PLY0|Q4PLY0_IXOSC F1F0-type ATP synthase subunit g OS=Ixodes scapularis P Ixodes scapularis 1 0.068 tr|B7PMA8|B7PMA8_IXOSC Putative uncharacterized protein OS=Ixodes scapularis G Ixodes scapularis 1 0.080 tr|B7PF38|B7PF38_IXOSC (S)-2-hydroxy-acid oxidase, putative OS=Ixodes scapular Ixodes scapularis 1 0.080 tr|B7PQ21|B7PQ21_IXOSC DEAD box ATP-dependent RNA helicase, putative (Fragment Ixodes scapularis 1 0.081 tr|B7QIE9|B7QIE9_IXOSC Nudix hydrolase, putative OS=Ixodes scapularis GN=IscW_ Ixodes scapularis 1 0.082 tr|B7P4E1|B7P4E1_IXOSC Glutamate dehydrogenase, putative OS=Ixodes scapularis Ixodes scapularis 1 0.082 tr|B7QH59|B7QH59_IXOSC Nuclear distribution protein NUDC, putative (Fragment) Ixodes scapularis 2 0.083 tr|B7PLL8|B7PLL8_IXOSC Estradiol 17-beta-dehydrogenase, putative OS=Ixodes sca Ixodes scapularis 1 0.084 tr|B7PPR8|B7PPR8_IXOSC FK506 binding protein (FKBP), putative OS=Ixodes scapul Ixodes scapularis 1 0.084 tr|B7PKP9|B7PKP9_IXOSC Glyceraldehyde 3-phosphate dehydrogenase OS=Ixodes scap Ixodes scapularis 1 0.087 tr|Q26229|Q26229_RHIAP Autoantigen OS=Rhipicephalus appendiculatus PE=2 SV=1 Rhipicephalus appendiculatus 1 0.088 tr|B7PL00|B7PL00_IXOSC Antiviral helicase Slh1, putative OS=Ixodes scapularis G Ixodes scapularis 1 0.088 tr|B7PYA7|B7PYA7_IXOSC Putative uncharacterized protein OS=Ixodes scapularis G Ixodes scapularis 1 0.090 tr|B7PZS8|B7PZS8_IXOSC Protein transport protein sec23, putative OS=Ixodes sca Ixodes scapularis 1 0.090 tr|B7PKV8|B7PKV8_IXOSC RNA-binding protein, putative OS=Ixodes scapularis GN=I Ixodes scapularis 1 0.095 tr|B7PNU5|B7PNU5_IXOSC Glutamine synthetase, putative OS=Ixodes scapularis GN= Ixodes scapularis 1 0.095 tr|B7P7A4|B7P7A4_IXOSC Importin, putative OS=Ixodes scapularis GN=IscW_ISCW016 Ixodes scapularis 1 0.097 tr|Q17248|Q17248_BOOMI Angiotensin-converting enzyme-like protein OS=Boophilus Boophilus microplus 1 0.098 a Number of peptides by which proteins were identified. b False discovery rate (FDR) is used as a measure of statistical significance of peptide identification and is calculated using the refined method proposed by 174 . Supplementary Table 36. Summary of F statistics for filtered RAD loci. Heterozygosity within a subpopulation of I. scapularis collected from different geographic regions and the Wikel laboratory colony. Sample n T % pol SNP Private P Ho HE FIS π Mid West Wisconsin 12 3,365,898 7.08 589,587 51,068 0.989 0.013 0.016 0.012 0.017 Indiana 10 3,368,281 4.76 581,843 22,650 0.990 0.013 0.014 0.006 0.015 North East Maine 10 3,654,874 6.31 622,432 35,573 0.989 0.013 0.016 0.011 0.017 New Hampshire 10 3,433,477 6.40 594,562 34,352 0.989 0.013 0.016 0.011 0.017 Massachusetts 7 3,362,822 5.52 584,514 26,532 0.989 0.014 0.015 0.007 0.017 South East Virginia 10 3,180,531 5.22 555,145 44,662 0.989 0.016 0.016 0.005 0.020 North Carolina 5 3,709,763 5.56 636,280 66,486 0.988 0.015 0.017 0.011 0.019 Florida 5 2,741,357 7.48 500,178 80,789 0.988 0.016 0.018 0.010 0.019 Reference Wikel 5 3,786,899 3.80 628,131 22,051 0.990 0.014 0.013 0.003 0.015 n - number of analyzed individuals from each population; T - the number of RAD loci; % pol - percentage of polymorphic loci; SNP - total number of SNPs; private - the number of private SNPs; P - average frequency of the more common allele; HO, HE – observed and expected heterozygosity at polymorphic sites; FIS - fixation index across polymorphic sites; π – average nucleotide diversity (calculated across polymorphic and non-variant sites) Supplementary Table 37. Genetic variation among populations of I. scapularis collected from different geographic regions of the U.S. and the Wikel laboratory colony. FST values are shown as a measure of differentiation. FST = <0.05, low genetic variation (light tan shading); FST = 0.05-0.15, moderate genetic variation (tan shading); FST = 0.15-0.25, high genetic variation (orange shading); FST = >0.25, very high genetic variation 178. Location Sample IN ME NH MA VA NC FL Wikel Mid West WI 0.045 0.037 0.040 0.042 0.100 0.119 0.102 0.072 IN 0.055 0.057 0.064 0.132 0.153 0.124 0.106 North East ME 0.038 0.043 0.106 0.127 0.106 0.078 NH 0.046 0.105 0.125 0.104 0.079 MA 0.119 0.139 0.113 0.092 South East VA 0.091 0.079 0.142 NC 0.072 0.161 FL 0.123 Abbreviations: Indiana, IN; Maine, ME; New Hampshire, NH; Massachusets, MA; Virginia, VA; North Carolina, NC; Florida, FL; Wisconsin, WI. Supplementary Table 38. Proposed tick and mite genomes, clinical significance and sequencing priority. Acari Classification Species/Geographic Region Diseases Transmitted a Sequencing Priority Superorder Acariformes Leptotrombidium deliense Asia Scrub typhus Tier 1 Superorder Parasitiformes Family Ixodidae (hard ticks) Lineage Prostriata Lineage Metastriata Ixodes scapularis Nth. America LD, HGA, babesiosis, POW Ixodes pacificus Nth. America LD, HGA Tier 2 Ixodes ricinus Africa/Eurasia LD, TBE, babesiosis, HGA Ixodes persulcatus Eurasia LD, TBE Dermacentor variabilis Nth. & Central America RMSF, tularemia, anaplasmosis, tick- induced paralysis Amblyomma americanum Nth., Central & Sth. America HME, STARI, tularemia Family Argasidae (soft ticks) Ornithodorus turicata Nth. America TBRF Tier 3 a From 186,187 ; human babesiosis (Babesia microti); HGA, human granulocytic anaplasmosis (Anaplasma phagocytophilum); HME, human monocytic erhlichiosis (E. chaffeensis); LD, Lyme disease (Borrelia burgdorferi); POW, Powassan virus; RMSF, Rocky Mountain spotted fever (Rickettsia rickettsii); scrub typhus (Orientia tsutsugamushi), STARI, southern tick-associated rash illness (Borrelia lonestari); TBRF, tick-borne relapsing fever (Borrelia turicatae.); ND, not determined. Supplementary Note 1 Predicted Protein Sequence of Ixodes scapularis Gustatory Receptors (GRs) >IsGr1FIX MLRGFQLQSKFCRVSGCLFLPGLLTNPLETVSVTWKSWYSFYSALCFLFFVGYESNLITRYVLKIDGSDHLFSQSLI VLMHVVVVLKSVVNYISMITGSRSILDFLRESALFEEAIDFPSCKCCIPKEYFRADVKRILLFVVFFLVYCVGTHFQ LNDVFGSEKPWSAQYVMYRVCGMLTGILFFTYDSLHFVSVKVCSKVLGEYIKTQLKVIETCVSHSPGGSLEQAAKDV EAVRMRLCIIRNLKTTLNDVWNRSIVTSCACQILVLCIAIFTVCTGGLARQDLWMALAYSLYTVYETVDLANVSQSM ANNVQNVKEACKRAATFDGPEFFIQQIQYLHNSINPQDFTVVGGDFFSIDMPLLVSITGSVITYSVILVQTSQEFDT NTNVDGANGTRPGSVPGS >IsGr2FIX MLRSFQLQARFCRVCGCLFLPGLLTNPLDTVKVTWQSWYTFYSAACFIFFVWYEFNLITRYVLMIDGSDHLFTQSLH VLMHIVVVLKSLVNYVSMISGSRSILDFFREAESFEGTIDIPSCKCCVFKTFMWADVRRMLLFVAYLAIYLAGTHFQ LIDVLGGQELGSEQYVLYRVGAVFAGILFFTYDSLHFVSLKVCSLVLEEYVKTQCKVIEVCVSLRPTGSMDQTAKEV ETVRVRLCVIGNLKTTLNDVWNRSIVTSCACQILVVCIAIFTICTGGLARQELWLALIYSLYTVYETVDLASVSQSL SNSMKKIKNACKGAPTFEGTEAYNKQIQHLHNSINPQDINVVGGDLFRIDMPLLVSITGSVITYSVILVQTSQEFDT NTNVEGANGTRPGY >IsGr3FIX MLQRCVPFAIACRLFGCFFIHNFPGKSLDQAKVSWKSLYTLYSFTCFIAYLVSEIAYVIRYVDELGKISRSFSRSLL LLVHVVITARIATNVAAMLMGPEKLLAFFRQSESFEKAIDFTTRQRSLRTSAFERWAALRAFLSLSGMAFCYAAGVN FLMGQLEESLGSRWVIPTRIVGFFMITAVLLYDSLLYLFLRSSAKVFGEYMHTLLGAFKKCKRYRSIRSRSGVSCHI EFIRSNMNEVKRLKEALSDIWTWPLMVASASLVIMNSFVFSAVIQDGLKKELWWAVTYSLYSTLSFIDLAYVSQALV NEARKLKDAILVVPTYDATDDFSQQLRYLHETIDPDGMCFGGGGFFALKNSLLVSMTGAILVYTVILVQTSDTMDHK MDAT >IsGr4CTE MISFMHQRCVPYAILGRLYGCFFVHNFWRKSLGDAHVTWKSLYTVYSFGFFVIYLLGEIMFATSFARDVKDVSDAFS RHLLILVHGVVTTRVLANSVAMLTKPNKLLAFFRKSEAFEKDTAFSLRTYSLCSSVAHRWNAMRAFAAFLGLTLSYS VAIQFLAMEHGEQILSQMAVPVKLVGFIMTTGFFVYDSMLYLFLRSCINVLVEYTQFQLVVFREQNLLFRPGEPSKI EAMRLSLNKMRKLKELLNDIWAGPLIVACASTVITDCVILDAMFYDGMKQELWIIAAYALSASLSFIDLACTGQTLI DEARKLKSAMLMVRAYGEPDRYLKQLRYLYEGFDPEGMCLDGGGFFVLRKSLLLP >IsGr5INT MISLMQRQFLPYALLCRLGGCFFIPRFWKPLEDAKVTWRSLYTAYSAFAVASWFSVELTFIVKRCHIYSNLSYHDFP SLVLLILRATVSLKALLNFVTMATGSSGLVKFFRKASVFEKTTGFLPSSRCPKGVWKDRWSFLRRFFVVQGIVSSYV FSTLLSSVSLTADLPADFGFLGKLGAVLTGMYYLLYDVFPYIVLSSCSSVLVAYLQAQVKMFERCCRFEAVHNNMQL SQQLEVIRHNLGGIRDLKHSLNAIWEAPLVAMSVGVLLDVCVVFYAIFHDGFFRSHVRLAMSYCLYSSFAFMDMACI SQALTDEAQKLKDATKAAYTFAATNGYVQQMAGTMITYTVILSQTSDGLANKAVPRN >IsGr6CTE MSSYMQRQFVPYAILCRLGGCFFIQNFWKPLENAKVTWKSLYTAYSVFFIALNFSLDIVLIVQESYVFRDLSQAFSP SLILVLRMVVTSKILLSAGTMATGSLGLLEFFKKSSLYEKITGFSPARRDFRAFWKHRWSLFRRILVLIGFICTYII SMLPFMYSLGELLPASFSFLGQISAVLGAWCYLLYDALPYMVLRSCSAVLVEYLHVQLKTVQRCCKVKPSRNERKSL EQLEVIRHNMAKITDLKDCLNAIAQVPLATMSAGVLIFDCVVCYAMFNDGFFATDVPLALSYCVYSSFAFLDLAFAS QALTDEAQKLSNATKVAPTFGASDEYVQELRYLHKTIDPDGMCLSAGGFFRLNKSLLLT >IsGr7INT MTSFMQRQFVPYAIPFRVGGCFFIENFWKPLEHARITWSNLYVAYSASLVGVSFGVEMWDIVESSDILNNLSHALYP CLLLILRAITNFKLLLNVVTMATGSIKFLEFFKKASIFEKATRFSPVRRGFWFFLTNHWSFMRQLVLIISLTSNCVI SMVAFAVTVTNLLPNSFRFIGGLIAALICTCYLIYDVLPYIVLRSCSAVLVDYLQAQLRLFESCCNAKAVRAEGHLS RQLEAIRHNFGMIRDLKESLNAIWQLPLAVMSVTVLLLVCVDCYGMFHDTFQGLGILLAVSYCLYAAFALVDLACVS QFLTDEAQKFKNATKMALTFEVTGRHVQQMAGTFITYTVIIAQTGEELRNKATSGNSTIPN >IsGr8PSE MQWQFVSYAIIIWIGACFCIQNFZKSPDNAKATWMSLYIACSACLVVVFFCFEITPILKIFIAFNDLSHVFSSSLVF ILRCLVCFKVLVNRASMATGTNRLLEFFKKSSIFEKKKTEFSPCSRGTRDILRPRWSFZRRSLVVLVTVSTYAILTZ NLMSSLKQVYPLMZTFWASVLLSYLGZPTSSTILPHSWSZGTTLQSWWSIFKLNZNFWNVAVNDSLFELRSCLNNLV IHHNIGNMZYLKDSLNVMWQVPLIVMSAGIILLVCVACHPMFFRLXFAPKFPLTASSSVYPSLAFIDMVFSSQSLPG EAENFKIASKKAFAFEAVDGIRHQ >IsGr9 MKSLMLHRFYAYGLLCRIGGCFFIQNFNRHSLDKARIAWKSLYTLYSALCVLFSFGFFIWFDVAFIIREASTAYGLS GLFSETLSLTLHAVVSSRILINLSLMIAGSGKLLDFFRRAVIFEQTTGFEPAKCCAPLSRKPGWSLLRRTLVVVTLA TSYVLLVNFYIVHYTGAISPEWALTSKVVGSIAAVFLFLYDSLCYVVLRCCSGVLLEYVSAQLRAFQDCSKPKDILP QMQASRQLETIRLNVCSIRELTQILNSIWKASLAGKCAGIILANCVVLYSMFHDGVFKRQIWVTLSYCAYSSLAFLE LVFISQALIDETQELKNATKKVRTSDATDNYAQELQYLHQSIDPKGMCLSGGGFFRLSKSLLVTMAGSIITYTVILV QTSDELTSKMESVGAPPGS >IsGr10 MRSFMLQRFAGYGKLCRIGGCLFIQNFHKESLASARVTWKCPYTLYSILCVCFVFSFEVAFLALRMRVLSLFSSRFT QSLLFILHITIIFKIFINFWAMATGSGKLLDFFRKAVIFEKSTGFSCVKGRFRWPIPRRCLVLAALVANYVIGVRLF IGEVVNALPRQWILAATICGYVAGFGFVLYDSLPFVVLRCSTEALVEYTHSQMLAFKGCDRTKGACTDMNASRRIET IRLNLCNIRELNRLLNDMWKCPLTAMCANVILMSCIVLYSLFENGIYMREVWVVLLYTLYSALCFFELTLISQALSD EVQRLKDATRAVITTDATEDYLHQLRVLHDTIEPLGMCLSGGGFFSLKKPLLVSMTAAIITYTVILVQTSDDITEKT DVYSAFPRR >IsGr11FIX MSSYMLRRFARYGRLCRVGGCFFIKNFNEKSLEKATVTWKSLYTVYSTLCFCFFFWFEAAFIVQKAYVITFFSRSFA HSLLFILHTVVSCKIFVNFSAMVVGSAKLLDFFRKSDTFEKSTGFAQPQKRRSPMVRRSLVIVALVISYVIGIHLFV GDITNELPRQWVIAAKVSGYIAGVGFFLYDSLPFVVLMCCNEVLVEYTHAQLVHFKVCDRSKAACSDLDASRHMETI RINLCQIRKLKDTLNTVWKWPLAAMSASILLILCIVLYAVFDGGLFLRDIWIILAYSVYSTLCFVEMTFVSQALMSE AQRLKDATKAVLTTDATDPYGKELRYLHDVIDPVDMCLTGGGFFRLKKSLLVSMAGAIITYAVILVQTSDALAERIG GDFSTTLKNWFNVTSSRNTTGESG >IsGr12FIX MNSFMLKRFAAYGMLCRLGGCFFIKDLRRNTLEKARVSWKSPYLLYSASCLTSIIAFQVTYIMKRVEVFNNISQTFS RLLLIILQTIITLKIGINFASMTTGSAKLLEFFRKSATFEKSTGFPVCKGSWTTSSTSPWSLLRRLCFAVALINSYV ITMHFFVGGLANNLPPQWILAGKIVGCIAGLFFFLYDSLPYVVLRCCSSVLVEYIRAQLITFERCNESNVFRLESQT TLQLEAIRCNLGFVKELKDSLNAAWKCPLAAMSTSIIFLVCVVFYSMFQDGVYKEQIWIALSYCVYSSLSFVEMAYV SQALMDEAQKLKDATKRVHTSHATDDYARQLRYLHDSIEPKGMCLSGGGFFRLNKSLLVSMAGAMITYTVILVQTND GLSNKIDSSNASMVGGIVVREPL >IsGr13FIX MSSFMQRQFMPYAVLCRLGGCFFIRNFRKPLENSNVVCKSVYTAYSAFIILLCFSFQVILFIRKAHVFKNFSHDFSP FLLHIVRTIMILKALLNAVIMATGSATLLEFFRKSSAFEKTTGFSPSTQGVRGIWRRRWSFFRQSLVVIGAVITYFI SAIPFITSLTEMLPTDLHFLRKLGVVIITAYYLLYDALPYMVLRSCSTVLIAYLQFQRKMFERCCELKSSYNKTELS GQLEVIRHHLGHIRDLKDFLNTIWQVPLAAMSAAILLCACIVCYTMFHDGFSAEDIPLAVSFCVYSSLAFVDMALVS QTLHDEAQKLKNATKTAFTFEAADVCVQQLRYLHETIDPKGMYLCGGGFLRINKALLVSMAGTMITYTVIISQTSDG LANKAAPTD >IsGr14 MQSVMLERFSLYGQLCRYGGCFFIQQLKSLENAKVVWKDLYTLYSATCVIFSFSFFLLLEVLFVLETNNFSTSIQSD KFSDILIQTQHVVVSSKVLVNFLSMATGSGDLLNYFKKAAAFEKRSGFVPSKRCVRTLGEERWSLFRRVLVLVALAT SYILFMHFYVAHVADTVARVWAIACKIIGPIAGFLFFLYDTLCYGVLRCCSGVLLEYIRAQLREFEDCTRSNGALSG TEACRRLERIRLNMCSIRELSQNLNSTWNASLAATVAGIILANCVVSYSIFIDGIFEREVWIALAYCVYTSLVVLEL VYMSQALMDETQKLKNATKNIRPFDLSRDCSQELRYLHDSIDPKDMCLTGGGFFRLNKPLLVSITGSIITYTVILVQ TSNKLTSSTDFVVAPPAPYHK >IsGr15 MSSYMLQRFAGYGMLCRFGGCFFIQNFSKKSLEKATVTWKSPYTVYSILCFCFFFWFEAAFIVQKAYVLTIFSRSFA RSLLFILHTVVTYKIFVNFSAMVMGTTKLLDFFRMSGAFEHSTGFRIPEKHRWPMARCCLVVAVLVISYAIGIHFFV GEVTNGLPRQWVIAAKVCGYIAGAGFFLYDSLPFVVLRCCTEVLVEYIHAQSLSFRDCDRSKVARTDQDASREIENI RINLSQIRKLKDTLNDVWKLPLAAMSASILLILCVVLYSVFDNGLYLRDIWIILTYSAYSTLCFLEMTCVSQALMDE AQRLKDAVRAVPTTDATEAYVQQLRYLHDVIDPVDMCLTGGGFFCIKKSLLVSMAGAIITYTVILVQTSDELAQKID DALPTTSLKNWFNFSSTNAISQDG >IsGr16FIX MSSVMLRNFLPYGRFCRFSGCLFIQNFRKRPESMRVQWMSWYTIYSAFCFAVFAIVQASYIFERVILFLTNIRLFTK SLFIVMQFAIVTKIVVNLSSNILGAASMVRFFRECAVFETSTGFSPPKPARRLKFCHCIRLAMLTAFLVCSVLSTTF LIRRLLSPASGVLDVFVKIASVFSNYLFFVYDTHHFLILRPCSEVLILYIKAQADILSSALRVPDCWKRAATVDAVE RVRLNNCKIRNLKTNLNGVWKASIVTSSVVILLMVCVAVYSAFDAGVPRSHLVLSMAYGVYSTLDFVDMATLSQTLV NEAQKIKDSLKKVLTCQASESYVNQVHYLHNSLNPSDMALSGGGFFRLDMALLVSITGSIITYTVILVQTSEGAEHS MARNITRYYVRVSNRTNFRTLRLTHSPP >IsGr17CTE MSSYMLQKFATYAMLCRLGGCFFIQNFRKDSLTNARVSWKSPYTLYTASCLAVIAIYQVTYMVKRVDILEDISRNFS LSLILILQATITLKIAINFVSMVAGSARLLEFLQNSAAFEKSTCFLLCKGHGPSSSRRPWSLLRRLCIICALINSYV LAMHFFVGGLLTKALPAEWILAGKIMGSVTGLFFYLYDSLPYVVLRCCTAVLVEYVRAQLIIFERCNRSNVFTLGSQ ASQLLQVIRCNLVTIKELKQSLNAAWQCALAASSTGILFVVCIVVYSLFHEGLYKYHILTALSYCVYSSLSFMEIAY VSQALADE >IsGr18 MSSFMQRQFVPYAILCRLGGCFYIQNFRKPLENAEVTWKTLYTVYSALIVSFFFAFEMSSIIKISFVFRDLSRAFTA SLMLLLRCMLCLKILVNTATMATGSSRLLEFFEKSSTYETISGFSPASRGVRGLWRHRWSFFCRSLVVLGVISTYVM LTMYFTVSLMKLLPANLRFLGIPSGVLFGVNYILYDALPYMVLRSCSAVLVDYLQAQLKSFESCCKSRSARCDRQLP RQLEVIRYNLGVIRDLKDSFNAIWHVPLAAMSAGLILLVCVVWYAIFYEGLFAPQITLSASYCLYSSFAFIDMACVS QALTDEAQKLKNVTKIAFTFEVTDGYTQQLRYLHETIDPDDMCLSGGGFFRLNKSLLVSMAGTMITYTVIISQTSDG LTNNATPTN >IsGr19FJ MQPKGPLSPVMLRRFAAFGMLCRLGGCFFIQTFSSKSMENAKVSWKNFYTIYSASCFVSIASFQVAYVIHRAEILSD ITHSFSRSILLILSSTVSLKMIINFVSIMAGSSRLLEFFRNSARFEASTGFLSARPFASVATNHLWSKFHRVLVAVA LAISYAVGFHFFVSGLTELLPPQWILTGNILGVFVCALFHLYNSIPYMVLRCCSSVLVEYMRAQFVQFEGCKGLQGD SSDAHASQAIEVVRLNLGVIKQLKDSLNSTWHWSLGATCSGIIFMTCVVLFTMFQDGVHHREIWVSVSFLVYSWLSF LELVYVSQALVDEAQKLKDATKVAPMLHAAEGYIQQLRYLHDTIDPKGMCLSGGGFFRLNKSLLVSMTGSIITYTVI LSQNSDDLSQKIDLYS >IsGr20JI MQPKGPLSPVMLRRFAAFGMLCRLGGCFFIQTFSSKSMENAKVSWKNFYTIYSASCFVSIASFQVAYVIQRAEILSD ITHSFSRSIILIVGSTIALNMIINFVSIMAGSSRLLEFFRNSARFEALTGFLSARPFAIIATNHLWSKFHRVLVAVV LAISYAVGFHFFVSGLTELLPPQWILTGNILGVFVCALFHLYNSIPYMVLRCCSSVLVEYMQAQFVQFEGCAQKLKD ATKVAPMLHATEGYIQQLRYLHDTIDPKGMCISGGGFFRLNKSLLVSMTGSIITFTVILSQNSEDLAHKIDLYS >IsGr21FIX MQPKAPLSPVMLRNFAGFGMLCRLAGCFFIQSFSSKSVENAKVNWKNFYTIYSVTCLLSIVSFQVAYVIHRAEMISN ITHSFSRSILLIVSSTVSLNMIINFVSIVVGSYRLLQFLRNSARFEASTGFLSARPFASVATNHLWSKFHRVLVVVA LLNSYAVGFHFLVSGLTVLLPPQWILTGNIFGAFVCALFHLYNSIPYMVLRCCSSALVEYMRAQFVIFELCKGFQGA RSDAHASQVIETVRLNLGVIRELKESLNSIWHWSLGATCSGIIFMTCVVLFTLFQDGVHHREVWVSVSFLVYSWLSF VDMIYVSQALVDGAQKLKNATKVAPMLHAMECYIQQLRYLHDTIDPKGMCLSGGGFFRLKKSLLVLMTGTIITYTVI LSQNSDDLAHKIDLYS >IsGr22PSE MSSTMVQRSALHAIFSRLHGCFFIQNFHGKSLKNAKVTWKTPYTFYSFSWFAVYIFIEILFSIRFAYVIQNISDALS RSLLLVVLSVAVVKLTTNLAVMFTKPDKLLAFFRKSEAFETNTGFSPRSYSLLHSAADRWNAVRALAAFMGLVMYFS LAEWFIMVELIQTVPTQWSVPVGNIGFLHGNRFLSFYDSLSYFFLRNCTNVLIEYIQVTVEGFQEANKWKHFHFQPD APLQIEAMRLRINKFGSSRDTEZHLGRTLIVACAGTVIIDCVVVDAVFHDGIKKELWLGAGYFVYSSLCFIDLAYTG QALVNEVRKLKSAILMVPAFGAPDTYLQQLRYLHESVDPEGMSFGGGSFFVLKKSLVLSMIGSVIIFGVILVQTSNS VAFKINTT >IsGr23PSE MAGHSLATGQRTIAIHWPMTGQICDAWGCSFIHDFKRKSLNNAQVDWKTPYTFYSFSCFVIYLFLTTLFATRFAYVI KGISDALSRTLLLVIYSVIVVKITTILAVMFTKWNKLLACVRKSEAFKSNTSFFVXPHSAWHSAAZIWSVGRVLAVF VGLALYFAAAEWILMVELTSSMPPEWSDLVRLFDFFMGIGSMVYDPVLYLFLTTCTZVLEEYIHVQMKPFQEAXRED FNIHPQFLLQIEAMRLRIFKVRQLKESLNIIWADTIIVACAITXADCVVLDAVFHDGTRKELWIAVSCELYASLCFN DLAYTGQTLIDEXLPPTVVSRADYPYNQKVVYLHESVDAEKICLGGGGSFFLKKSLLPSMTGAIIIFGVILVQTSNF QKLNIKAA >IsGr24 MVSVMVQRCVPYAILGRLQGCFFIHNFRGKSLRNAKVTWKTPYTFYSISCYIFYILLETLFATHFARVIRNISDALS RSLLLVVFGVVVVKVIANLSVMLTKPDELLVFFRKSEAFETTTGFSSCTRRSQDSAAVRWKVLRKCGVYMGQVLYFT LTERFIMVDIAQSMPPEWSVPTKIFAFFLGIGFLCYESLSYFFVRSCTEVLVEYIQIQVELFQKAGELSHVGFQPPF SSQVDAMRLRIDSIRKLKESLNNIWAGPLIVSCANTIIVDCVVVDAVFHDGIRTELWLVAGYSVYASLCFVDLAYTG QAFIDEVRKLKSAILMVPTYGASDSYLRQLRYLHESVDPDEMCLGGGSFFVLKRSLLLSMTGSVIIFGVILVQTSNT MSLRINAA >IsGr25 MVSIMVKRSLPFAIVARLQGCFFIPNFGGNSLRNVKVTWKTPYTIFSISCFAFYMFLEFLFAKQFSHVVANISDTLS RSLLLVVFGVCVVKVLVNLSVMLTKSKKLLAFYRKSEAFETSTGFSLHTHSLRHSSAHRWNAVRACGVYMALALCFT NVERFILVDMAQSVPTEWSVLMKIFGVSLGFGFIFYESLSYFFLRSCIQVLGEYIQVQVELFQKDVQCSNVHLQPQF SSQVQAVRLHMSKIKELKELLNDIWAEALIVTCANAIILDCVVLDAVFHDGIRKELWLAAFYSLYAPLCIVDLAFTG QGLINEARKLQGVILMVPAFGAPESYLQQLRYLHESVDPDGMCLGGGGFFLLKRSLLLSMTGSIIIFGVILVQTSNT VTLKINAG >IsGr26 MTSMMVQRSTPYAIFCRLCGCFFIHNFRGKSLRNAKVALKSRYTFYSFSWFLLYMFLEALFSKRFGYVIRNISDPLS RALMLVVLGVGLVKLITNLAVMILKPDKLLAFFRESEAFEMTTEFLPQAHSLRNSAAYGWHAVRAFSAVVGLGLFFI EAERFIIVELSQSLSPQWSVPLRVIGFVAGTGYVAYDSLSYFFLRNCTKVLVKYIQVQVELFQKVGKLNNFYFLAQS PHQVEAMRLRINKIKKLKESLNAIWAEPLIVACAGTIIIDCVVVDALVHDGIKKELWLAAGYSVYSTLCFIDLAHTG QTLIDEVRKLKSAILMVPAFGAPESCLQQLRYLHESVQPEGMGLSGGSFFVLKRSLLLSMTGSIIIFGVILIQTSNT MTLKVNAA >IsGr27 MSSTMVQRVALYSLLCRLYGCFFIQNFREKTLANAKATWKALYTLYSISCFVLWFVIEMLCFTNYTDVVRSISDTLS KTLLLVAYGVLVVKLIVNLAVMFTKPDKMLTFFRKSEAFENNTGFTPRTNSLLRSATDRWNMVRALAVFMGFALYLT GALWYVRTELLKSIPPLWFVPVIILGTYMFIGFLLYDSVSHLFLRSCTNVLVQYIRAQAEVIKEAGKLTNFHLQSQS PLQMEAVRLRINKIRKLKESLNEIWAGPLIVHCASTLVVDCVILDAVFHDGIRKELYIILICSLYTSIGFIDLAYIG QTLIDEARSLKNTILMLPAFGAPDSYIQQLRYLHESVDPEGMCLGGKGFFALKRSLLVAMTGSVIIFGVILVQTSKS MALKINAA >IsGr28 MRSLMLQRAAPYAILCRLHGCFFIHNFRGNSLRNAKVNWKTPYTIYSLSFFGLYLILEEMYATRFTYVIRNISDTLS KYLLLVIYGVVMVKIIANLTVMLAKPDKLLAFFLKSEVFETNTGFSPRTYSLQHSTFHRWNAVRAIWVFMAFVLFFT EAERFMIAELTRSMPPQKSVPLTIFGFIMGSGFMVYDSLSYLFLRCCTKVLVEYIHVEVQGFQEAGKLQNIPFHLHS PREIEATRLRMNNIRKLKESFNEIWEGPLILACASTIMVNCVVLDAMFHDGMRKELWLAVAYSLYSSLCFIDLAYTG QSLIDEVRKLKSAILMVPAFEAPDCYLTQLRYLHEVVDPEGMCLGGGGFFVLKRSLLVPMTGSIIIFGVILVQTSNT LALKNNAT >IsGr29FIX MSSTMVQRVALFSLLCRLYGCFFIQNFRGKSLADAKATLKSPYTLYSFSCFGLYFLLEAMFSTQYEGSVETISATLS KTLLLVAYGVVVVKLIVNLAVMFTKPDKMLTFFRKSDAFERSTSFTPRTYSWRRSAKQRSSRVRARVVFMVYALYLT VAEWYIMAEVLQSIPPRWSVPVIILGIIMGIGFFVYDSVSHVFLRSCTHVLVQYIRVQAEFIKEAGKLTNFPLHPKS SLQMEAVRLRINKIRKLKDLLNDIWAGPLIVHCASTLLVDCVTLDAVFHDGIRKELWIIVICSLYTSVGFIDLAYTG QTLIDEAHRLKNTILMLPAFGAPDSYLQQLRYLYESVDPKEMCLGGGGFLALRRSLLVAMTGSVITFGVVLVQTSKS MARLVNAA >IsGr30FIX MSSTMVQRSALYAMLGRLHGCFFIHNFHGKSLKNAKVTWKTRYTIYSFSWFAVYIFIETLFSVRFARVIQSISDALS RSLLLLVLCVAAVKLMTNLAVMFTKPDKLLAFFRNSEAFETNTGFSPRSYSLLHSAADRWNAVRALAAFMGLVMYFS LAEWFIMVELIQTVPTQWSVPVVIFGFFTGTGFILYDSLSYFFLKNCTNVLIDYIQVQVEFFQNAGKWKNFQLQPQS PLQIEAMRLRINKIRKLKETLNNIWAGTLIVACAGTVIIDCVVVDAVFHDGIKKELWIGAGYSVYSSLCFIDLAYTG QALVDEVRKLKSAILMVPTFGAPDTYLQQLRYLHESVDPEGMCFEGGGFFVLKKSLVLSMIGSVIIFGVILVQTSNS LTLKINST >IsGr31FIX MSSTMVQRCALYAILGRLHGCFFINNFHGKSLKNAKVTWKTPYTIYSFSWFAVYIFIEILFSIRFAYVIQNISDALS RSLLLVVLSVAVVKLTTNLAVMFTKPDKLLAFFRKAEAFETNTGFSPRSYSLLHSAADRWNAVRALAAFMGLVMYFS LAEWFVMVELMQTVPTQWSVPVGIFGFFTGTGFILYDSMAYYFLKNCTNVLIEYIQVQVELFQKAGRWKNFQFQPQS PLQIEAMRLRINKIRKLKETLNNIWAGTLIVACAGTVIIDCVIVDAVFHDGIKKELWIGAGYSVYSTLCFIDLAYTG QALVDEVRKLKSAILMVPTFGAPDTYLQQLRHLHESVDPEGMFFDGGGFFVLKKSVLLSMIGSVITFGVILVQTSNS LTLKINST >IsGr32FIX MVERSTIPAIVFRVFGCFFVPNFSGESLAQAKVTWKSFYTCYSLACFVVYIFAETAFVIRSLDVLRDVSHSFSRSLM LTVHVIVTARITGNLVAMLTGQEKLLEFFWNSESFEKNIGFLPHARSKRGKRSTRRWATMRMFLVVFGMVLCYAAGV YYRIGQSAQSIGASWVLPVKIIGVCMAAGLVVYDSLSYLLLRNSATVLAEYIRAQLEAFKECRRSSSINLQNKVSGQ IESIRLNMSKVKKLKESLNNIWNWPLMVASASLVIMNCIVFNGIFHDGFKQEIWLSITYALHASLCFIDLAFASQAL VDEARELKNATLVVPTFETMEDLLHQLRFLHETIDPDAMCFSGGGFFSINNSLLVSITGSIIVFTVILVQTSDTIDA DAA >IsGr33 MSSYVEREFKFVARSCRLSGCLFVSNSWSGRFAEFRPNFRSWYALYFGFLGVVTCGFEITLLHRRISYIYMREKDFS ELLFMIIHIVIGLNIATNTLVFILGTERLIDILRSTKRLEGAMGFEPARSSRVDDARKLFKMFLFAIFQAAFVLSRL ASSKEIFQEPSTALTVIVTICFSLSCVGYAIHGTVVLNANMFFYSVLSEYLKPQVAIVETLSSQILARNPRYTAKIL ERTRLHFVSIRNIVRSVDRLFEWGLVVSFLTCAFTLCFTLYSLFDASTSWSKMYIYIIYSVNSSANISELTHAAFRM KQQALHIKHVLEKTPLVNLPRRLVLQVEFFAENIEAEQLCVTGSGFFTVDKPVLTSPKEHRAAISVLLIGRSAVDEI AA >IsGr34 MTVIETRFRRSTRILRWAGAWFIEDATNPARQPLKTMLTRPYTWYCIFCFSILFCIELSLIFWTLLFSFGERKMFLN TLFVVLHITVVTKTLLSVVSLALSASKFKKLVNKARHFEVSRNFKPLPQHKKRITKASLRIWGQAILIVVFVVVRNT DMMLMVEISNIFLAIVLNVVMGAASVLLVIYDGMYSTVLKGLVEIYVAYLKKEVDILKKARTATGPQASSILEDCRL DVNSVQTLIRYTNRIMKYAIVIAYGGNLIMLCGIAYCLVDPTSKWSLRIFCFCYGVLISLDMVDIGFLVESLKMQAS KMKWVLQSMNFLGLPDSFSKQVRFLHDCLESGQMDFSACGFFKVNLTLLISMGGAIITYTVILVQTSQGLSM >IsGr35 MTFAYSQFRYSTRLLRWGGVWIVAEATNPGKQSFKTTLKRPYFWYCVLCLSTLVGTEFGNIIWALLFSFKHRKVFVS GVYTATQITVLVKTMLSSLMVALAAGRLKKLVARANQFEIIRNIKIAPRSKKVTWRDIRIWGRVLFMVLFVSIRNMD NLSILDVENIFGLGALVVVMTASSMLLVIYDCLYSTVFKSLVEIFIEYLRYEIRVLKKMKMELNSGPSMKMVEDCRI EFNTIQGFVKSTNQVMRYAFVMAYAGNLIMLCNIVYLLVDTAATPWALRIFSSTYGILMWIDMIDNGVVAEGIKASK MKWLLQSMPFQGLPDSFAKQVRFLHDIVDDSAMYFTGAGFFRINLPQLVSMGSTIITYTVILIQTSQGLQA >IsGr36INT MSNLAEQFDAVAKFGHATGSLFITRTSDGTSPKYRTMFRSLYSLYAMFIVGGCVIYEIFLLHFKVSGNSSLTTFSNT VFNTLLVIIAIRIAANVSIILSLSGKLADVLNHAEDFKASLPVKSGLQRKNRSFIDLIRRFLMFLSFAVFTLSRYLF FGELTSERPPSTATMATSAFVIVSTVVLTSACNFVHAIATLVYDLFTDDLGDLVAVAKVRLSPGSMLWGPRTARVLE DTRLKYLAMRKIIQELNDVLQYSTFVTVTCTLLTLCTCAYLISETESSWGKLVFTASYAVASSLELVHITVSMSQLK EQVQLFKESLDIQLFCASGLGFFTVDKPLLVSIFFSRLAYSLKVMQLCFDLLAIIIKISALRRMFI >IsGr37 MLLMKQQQSSLRTYECRPDSFFAGIAVGAYVATIEPRRRMKDTDRLNTTIYILFLTSVNVEAVINNFLMFVKAPKFV ELLHLCAKIEMNIGTPPYVQHDTISFTWKIMAFQAVLSCCNFVLNIISDFGTALVLSAEGQVSVDVMVIGILYSILG VVYVSSLCLVTRLWMTYFSKAFTLYLSCIYRNLDQCLRSRSTPESRKVSLVDHTRVQLTLLKNCADLASSLLGPSLL YAYAYSVALLCAAAYYTIIPELSNKIRLFFLCFGVLHWISILLPTVSAHRIKGAVIELRSIVQGVSMADFSDDLLAQ LRMMLNSIRHDDLKFTGCGFFVVDLSTFADIMGAVITYTVVLVQTNDSYLKGSLEHCLENSTII >IsGr38CTE MYFARARFAIDAGLLAVAGCSFPPLNDSLKGSFTTWREAYAVACICVAVALEAFAYVGKFTSNPALSSLFNNTLFFV IRIVNLVKVVALRFFLRAEARRVTELITQAEAYEESRNIRVRYRAPLFKTAYRCVSFVAVMSFFAARWHVYVKRLFS NSPLPLKAFLDFLTVLSASCMTVWDGIHTILVRYFADVFLEYLKAENVALTALTQRKVVGFGRAMSTALRGIESNYE EILRMVATARSVLRSLVFFGFTCNAVIVCAVLYSYTDGTSTISLLLSGTLYAAYTIAETLDITFAAETLATE >IsGr39CTE MGNNKMPAIYAGYRQFFVFCRIAGCCFVDGAFIRHGCSDLKIKIWSWYILYSLAGLWFYFWAMAVLIGSESNRPIFD TPNMIFYGYNVLINIQAAISMLSLLRHSGTYLEIIKTCGDLEVAIGLPREQAQRKLEKISRRCLIFMILDSARGLAI NKRVLPLSLRFMWSLHDWVKMGLLACFEVGVYLVGIWASLSFWLVVYNASVLKEYFACVNARMVQALTDPTGPAESL QRVRLNHAALRGMVLKINNAFDLQVTLYYGISIYFLCASLYGVLLFPLTYADRAIRAIFVVCLATSVYVSARAAHNM TSE >IsGr40 MPAVREAYSAIYSGYRPFFLFCKLTGCCSIQGLWTKTLFDELKVKMTIWSALYSFLLLTCYVWTLVLFVEILVKQHF QHPSSPISTVKGLFYGYYVLLYLQSTVNAFTLVRHAGALLAIIRDCSSLETQIGLEKDRVRRRLIIVSRGCLGFMVL DCIKSLTLAYRVVPAAWLHLSWMHDWVKIVCVAFFLIGVMLVGLWFSMSFWMIVYNAYVLRHYFARVNELLVEGLSM GGDCGRALQRVRWYQAEIRDIVSRFNSVLGLQSTFYYGGSVYFMCATVFGAFLSNISVLVRIVRSVFVITMAIGLLV SARAGQKMTSERHLKKGEVPRCLFAFLRVKKVTWFLHLLLVTSEAGEKAFTGCGLFKVNLSMLVAISGAVITYTVVL VQTDEEAVRQCV >IsGr41JI MDGRVPAAYPGYRFFLAVARISGCCFIDGVLFKTGPWMLRPNFRLLSLVHFAFCVFLSLWPPASFVMVRAQSRKTLS QIHSITGYGFYAAIYGQALVNILNMAFKRSDLVDVVRMASQLERRLQVPKKAVERRLRQVSLMCFAFVLFDGFKYML GLRTVMLLAFSLLDESHVVFRAVFIPGFLLGCVLVTVWYNLSFWMIVYFSEMVRQYFAALNDSLELALSTSKESFEA AERIRTNLVALRKLLKKINSIIGVQALSYYAGSVFFLCATLYRILISEGALTDRVSRLTYLATMSAGIVISTRASHL MSQELHMLVLAAEDAQGCLTGCGMFVINLPLIVVVVGAVITYTIVLVQTSDSAMNIKCLHGGITP >IsGr42CTE MIKRRRNSSIYNEVIRFPSFKDGFQTLSTFHRCLGYSFFTWQERQGITQVIVSVWRPYLLYALCSWTFFVFVMLQDT YHVLFLAAEDNGDALKVIDKCILIFYFVRCIGIQIANSITVLLRSGRLREVVVALDTLETSFNRDTHLRSVAKIILS LNVLFSVTALVSILDEISGFDGYMEPLHMKITYSVFSLLFAETVCMLCYTWAMFFGKVFEAFIRCINEDIESLATLK QVRQLELDVLHNRFCDLSNAFGECNAILNTSLAVSVPLNILNASPWGYFILSTDGDAFHVFTDVLGFGTMCAELLVL CVYGSAAQTQ >IsGr43CTE MRVLRPRVLAVSPPSSAMLASPFKIQPSYPSGKSLLSGFSVIAYFHRLLGFCFISKDANGRPVSKIIGPYMIYAFIS WALYLFVIGSDIVRVSILLQDIRNRAIDKAIQILACVRCIGIEIATIVLLVTKSSQLVELLVTLEELEERLNRATSL RATAIRVVILNVIFSVTSVLSISAEIYGFDEYSAEAYMKILYGVFSLVFAENVCMISFSWLMFFCRVFGVYLSHVNE DIDCMSNELVVSIPELAELHRLFVNVGWAFARLEQLLGVAILVSFPLNIVSAAPWGYYMLKADKGTTMFMLDLIGFF TICAEMLATGVYARATNRE >IsGr44CTE MFTESIMSPTSSTKTFHAAFHQVNRLHRTFGYSFISRSFSPSGEHITCNRLGPYTVYFVLSWSMTVGVFVYDAIEAL AVYEDDEVLDKATTLLYSVRTISIQLCTMVAAVITAPKIRKVAAELGELEARLQRPTSLTRVSRNVLAANAIYSVVS FVALMPLMFQFRELSKNQLYWNIVYIGVNLFYGQTSVMITYSWSMFFSKVFAELIRSINQELREMCSPSYSRESRDV GDVHALFYGVIEAFEQCNSTFGISLVVLFSLNMLMAAPWGYWLIRNVGKPEVVSVNFLGFMVLCAQMAFVAIYSFYP STE >IsGr45CTE MLSAPSKTRYGEHRPSIASVLIREEWNKAPEAHVIIERFLKMTRLLGCGFIEGLFTDNASTLRPQRASWYLVYTLTC IGFIFACAVHGVRTNISRGTMDGDIYLAVCVFYLLQALATFLTMFMYAPQLVEIVTMCIEFEVRRPLALDQRRCLNH FFMAVVVWLTLDFVVKNFLRMALVALSPSVYEFFLNATIVSGVLLMLSWSTIPQVGVVVMSRWLTVFLCETQNMLVR CGELTGHFPLTVVTNYSR >IsGr46FC MLRRFLRMTRLAGCCFVEGLFASTEAGPKLTARRAVAVPPVLFVWPGVSWYHSFKSVLRNSSKATLDGDIYVALSAS FFLATNATAISMVLHAPKLVELIHMCDAFELKRPLRQRRKLNRLCTWIVLLLCAFTLHQNAFRLQRLVTTATALHFV RRLFTLLGVLFQLAWTHISPAGVFLMSRVLNAYAEEAHAALELIGE >IsGr47 MLDQWHLAVPKNEGVEPTLFRVPDLGLDSSRSRNPRKVFLQDTRPSVWRARELMIPGVLMCAVAMPGPFFQFMNPRF KLIMRMYQGLLYVGFTAYEAYRLIEFVEEFMKDEKTSLICFFHSLINTFLFPFVYIYVARKSESLGPLLSRWEDGHG HLKFIPERNVLKPKFLVNVYMALTVFLIVLFHSVNAARSCYEIAWNYSNRTFPVKAVIFMGKTAHHYVLQTMYSGLE SLAFSLMFLLWLLYNDFSCEVKTAPTLTIKTITAIREKYRSLCIVTEATANFLNSLLFLFFFRTSFDFMSSVIYYSM QDGRAMKLWILVYEGILTFINVFHNTALAEMSSLLSLQAKDTLYEVSKVPAEPQAYKDLLLFLEVYRKRPEAMAGCG VLQVDRALVLKLCGSTVTIVLILFQLDPNLSHKVSL >IsGr48 MQRNIIVTSKTPVMPFNAKAWAFKPESEHDTKKKTDDDRGTTWDYIKMTLMYIYATHIVSNAIAGSIRTGSMMYLIE TMTYTVRSVVSTVTTTYCFVKRGEINEIAQELQTFEGPEPTELLQKASRKRKYLRFSILCYSCLLIAMTSLFFVLVP AQKYFDKCFYGINLEKAGIPNAPAIMIGLIEWNSYNIIVTGSPLLMPWYMYLCDHLRAQMLYFRVSQRGILDSGPLN LAKFKRIQFMCAKMIDVERRLDNLFAPVLFLWIVDLLVNIVLPIRTLVNGIASFTLANVMSFFIEVIYSVSFFMILS FSLAQVDKEYRDLDEEMYRVRNSVPGEDWQLCQQVVHMETGIKSSRFTLTGWGLFEVDRSFILTIVGAVATYTVVLI QLTPGEETY >IsGr49 MITSEKQIQQKAQQKMFRRNLYMQVLETGSKGLLDKIGILKWPLLLVAYAYTVHTTINVFLTFMRIHNMMKVLDIAG YAARSFFACLNLRQAFQISTPSNRLLQRLSFGENQRRCFEVSTFLKVFVLVYFVVEVSLSIDFVLNGDIGEYVTSFL YGTNISTTNMTQEVIKAATFFNLTLFDILSIVPGLLMADYIAACLRLRRLLASFRITVMDGRVKKTVTCTEVKRYQD LSYDAWRELKRIDDIYTTVVFLWYLDIIINLVLSMRNLSKGISSRQFALDSAYYIVIFVTLSLSASSVDTEAKDLMQ EVKQLRSNIDEDDWQTGGQILLLETGLQSSRIVLNSGHFCVIDRPFILGVVGAIATYTILVVQLTPPG >IsGr50 MKVSSSFFGQSSARSRWAVKRLVWTVERSRNAKNQDVAIDVQVSQLANVGPFRFALKKALLLPTLWLLLCYGLHLAA TIGSAGSTLTSFAYLLAVGNLIRAFTSIVSIVHIITFRNDILNILTSIENIFHDSLSEFVSRTRRFSLNLCAFCFGS CLFHGTLICVSSLSGPWRDFYQARFYGVNCSRLPSAVRVIPILLDAPLLSITSSVTAMMACLFITVCYMLSLVTLHF SHTMNLMLSLSASGKLTPGRVKDALLRLFLTGDAVCKLNMTYGPIMFWWYVDLLRSFLFSIPALLVAVTTSKEFFHY SFVVVDLTRDVIVFLLMSLVASDMARHIEESVVHSLKVADSMDDVRSDVRLAVNVEMLVNAVQETKVQLSGREFFHV DRSLINRVLSIVATFAIIVFQFLS >IsGr51 MNSAQRSQTKKGPPQIDRSDVLRMFRGLFAMMKLVGLLPRDLPEVIEAEVDARSIARRMRRAGVLLFIVFGYLIHFS AATVYNVTHDGGFFGFFANCGYVLRNIFAALSLVHFLVFQRVLLRIVVDGFRIFEHPPLSIERKVRRATVLAACFVV STFVALQNTTVWVGFVDVQKYFNYYLYKGDVTQGTIPRQLGYLFSFIDATTYAIMESTLNCIITFHACVSLYLGCLC ENFVRIIREVSQQTSVSGGQVKALRRLMTRLSDVMVRFDRVGSPVVFCWYANIVGSLILSTPGILLGMRRAAPSDYA YMLTDLLTMLVILVALTFALADPTSLLRSSYVHALKISTKVDIDDEEVNHSAHVLMDSIISTKVAVTGCKCFQVTRD MVLSILTMTSTYIIVVYQYIEHAM >IsGr52 MNWAQYNLIKSGSSEIGRNDVLHMFRAMLVMMKLLGVLPRDLEGDIGHEIDARSIAKSMRRAGVLLFIVFGYLIHFS AATIYNVTHDGGFFGFFANCGYVLRNIFSALCLIHFLVFQRVLLRIVVDGFHIFEEPPRGIERRIRRATVLAVCFDV VSYLAIVNASSYCGYKDVQKYFNFYLYKGDVSNGTIHKQLGYVLSTLDATAYATIMSVIYWFISFHACVSLYLGYLC ENFAEIVRKVSRQSSVSGGQVKSLRRLTTRLSDILVRFDRVGHPVVFCWYLNIVSTLILSAPGILLGMRKASPYDYG YMLTDLITMLIVFVGVNFALADPARVFRSSFVHALKISTKVDINNEEVNHSAHVLIVSINSAKVAATGCKCFQVTRG MVLAILSMVSTYIIVVYQFIENAL >IsGr53 MEKSTPDRFRRVIRVSAAASRAFESNREHLQEDKNWLEMLFKELLVALKIHGIVIFKPDPNSVAPRKGNAKSLLRNV RPSVILLVVFTSYGIHYAASSFTSLGRNPNGLLSLFSDVAYLFRIATALFTAFYMTSVSTSVSSLLSDSTTIFQKTL PQNAIKSIRGYVIGMSVFAFANLLAFLGVKVTELYQSGFDGYYNYNLYDLAPKSKSVIYYAVPALDIAFCTIIITMP KWIMGFHVSVCKYLGCQAVSLSGTFASERVVVLKRAREFREYHSALCELIFRFDEIFNLVLFFWYADIIISFVLSVP YIIIRTDNSTPWTYAFVMVDVACNVALLVVFNMAASDPGRLARDAQLVVLKMSSRADPDDVRLNHELLLLANAVKVA KVEMSGWNCFDVQRGLTITVLSMLSTYVVIVYQMMHHTL >IsGr54 MPSSPVVSPETASKSVTMLEKCTRAAEEGTSITVPLKDVLKALRVFGIGPLTPRKLESRIKQGPSQDLTTHQIRYNQ LAWVIMHIWIVRLLLRLGQVFLGKGKVGEAAVELLRGLASSVSLNRIILYRRRVCHFFWSVDHVTDRSLSYGKLSSF TSVYTIGIWLYILVRLILDVANLFTTVGFKGYMEQWLLVDTIPGSLTFAVYIIAVPDTVIRRLILSGPTIFMISFYS QLMWVIVSQFNSFHCTLKRKCTGSRNFGSDRLRQLRIRHADLCLLVQDVDDIMSPLAFLWHAMMVLGACAEATHLLQ LKISEDAWAIVHISLDLAYMLVFFGIVSFSSAAVCQAYNATLNYVNLMSARMSQVDDAEFARQALLLMSQMQSISVS VTAWKFYDMNRAALITTLGAVVTYVVVVFQMAPKLLQGPSE >IsGr55 MKVGVRSFSTMIIFAPPRSKLLSQLEMLFKPLIYSFGSFSGPPGVSVSLRSRLTAYTTTLVVLTTLTCHLALLIMSL SRGFEHASIRRGCTCVRLACSLIIVVLLIRRSHEVIAFKSRLLSLYSHLPVLDPSSVRLGKAKLVVWCTAAFVYLQI SYATFQGFLPDTNEESMAAYFKELWFGLDNKHFPPLLTRCLWNLESFVFHVTTEAVVRVPVLFYVAACFLLKARLRD FRLMLGRQRWKQSMTTLTTLTVKELRDLQRLHGILTEAAQQLEDVFSPIIFCSYTTFVVHIIASLYNIFDRNLLYFS GAPGKIHLIRQVEVYLEFGLTVWFFLLLTVAAAFVNDEPSRLLPVVEKMILDVDELSVSSSFRAAFLLARFSRPFAQ LTAWRVCVISRGLVLTVMGAFLTYGVIFFQFVHLGNSAAK >IsGr56 MKKKPISKVFVPRSRNSESDAIFKIPMAALKFTGLFWNTTCRPARLLSFLLKISIVTTQAKLLSDAFTYETVDMVLY GSRILTANVSFIIFALQERNLRNAIKDLSDKASFLLPLQRQRKIRTLSCSLACVSAIIIAVFLSGPAYVLFFTDKRL QTDLLSRFVAYLNEVCFAVVIWYPLCFMPILFVNVSQTFAELLSQYNEMIPKLFCTENHNIYSLNCKFRHSREQRHE MRRLLSVCGKIFAPCLFIWYGPTFLGCCAELSNFMRQSDAWVHRYYKAVTSAHGWAMFWGVSLAAHHVYATGRASWD VLQDCTLRLPLDVGVHMELVMLKEDCRKIAMAFTIGGFYKLTLRTAFSVFSCMLTYAFVWYQIGPGSQPNVASHTNS D >IsGr57PSE MKKKPIPKLFVPRSRNKESNAIFKIPLVALKFTSFFWNTTSRSARLLSFVLKISIDVTQTKLLSDEFAZQTVNLVLY GSRILTANVSFIIFALQERSLRKVLKGLSDKAGCLLPLQKQZNIQMLNCTLACLSAIIIGVFLSGPAYIIFXTEKZL QKDLLSHFVAYLNEVCFALVIZYPLRFMTTLFVTVSQTFAELLSQYNEMIPKRLCTEDYYIYSLDXKFTNSRKQRHR MCHLLDVRVKIFASCLFIWYGPTLLGCCAELGTFMRQSDSWVQRYYKAVTSARGWAIFWXVSLVANPVYATRQVSWG ILQDCTLTLSVDVVVHMELVMLKEDSREILKAFTIGGFYMLTLIPAFSVFSCMLTZVFVWYQIGPGSQRSAAIYTSS G >IsGr58PSE SFLLKVSIDVTQAKLLSDAFTZQTVNLVLYGXRILTANVLFIISAXQXRSLRKVLKDLSDKAGCLLPLQKQZEIQTL NCTLAGLSRIIIGAFLSGPAYILFFTDKLLQTDLLSHFVAYFNEVCFALVIWYTLCFMPIMFVTVSZTSARLLSQYS EMILKRFXTEDYDICSLDCKFTDTTKQRHKMCRLLDDCCKIFAPCFFVWYGPTFLGCCAELSTFMRQSDSWMQRYYK AVTSAHGXLAMLANPVYATRRVSWGILQECTLRLSLDVVVHMELVILKEDSRDIVMAFTIGRFYELTLKTAFSVLSC MLTZAFVWYQIGPRSQRSAAIYTNSG >IsGr59NC SVFFTEANPKHSDRTLLFFVALIWYLNTLFVYGTLVFVPILFISFCLVLARAFKVHNVVIRNVHKSGLSLEADSLAQ VRIFYERICTLVTDLNEIFGPVIFSWYIMIVLSVCIDMTQLFSDTNLLKNTKEDEGFLFSLRGIYSLLSFLGTCLAA SRVSEEALAPLPHLHELTLRSWRLDMDTKMEAHFFLSRLSSSPVSMTGWNFFTINRSFILSVCAALTTYVVIIIQMN PKAMKTINKLVTTALNNTGNGTASSE >IsGr60NC AGSSTELTKFIMVRQTVPKHTHKTIIDVTYVQVKHFRSLVRVCAKNSDVQAGPVKRLHSIYTSLWNAVQKLDSQLSL AVFLWYVDLVLNIIISVRMVQHTLSQFNPYSAAGAYVQALYLGLMFLLMSYAAANLIVEVRHVDHDVCQLVCALTAV DGQTCNQVMLLQEEVANCRMAFTGWNCFNIDRSFILTVIGAIITYAVVLQQLT >IsGr61 MYTSRRTTKLFVIRHVDEKVDPENNRTVFKQLRPILWSLKLLGFYSDLYEDAERPVRPWYHDVSTWTCVTLGLLHAY ALASLTACIEGDFWATAYNFFRAGSAVVSSQAVISKGPQACALIHRLGTFSSRPGHNLKKTCTVMVLVVLGYVILRI AVHSMVLLDYNAHDLSKHAKIAWFGIESQLPASVLLPLCLVDVVLNSILVTGSLLLSVALYLALTVALRHRYEAFND AINRHVRDNVVRQEETQDQSWTTTRENRGLDVHELRELRQIQTDLGVAVLEMETHFSPTAFAWVSFFVLGVCAEVSR FLGHHESGLSDEHRILVIGLNLGSVTLLFVLLAVMSSRLSETSNASMMPLHRALGLSSDRPQEYHEGLLLISQLRAP AVVLTGWGFFYFSRGFVLTLAGALLSYVIIILQLNSDLDKEKEIGKDG >IsGr62CTE MSSRIFTVEPRSCDDDPDTTDPFRIILTSLNLLGVFSLGPSSGGTIFRRCVIAYRSVATFYIHYVAFAHLYSLCSGV RGWTDIITSFIACSSVFTLDSLSLRRERMECLLLSMRTClaEGSVKARWAVLRKSRVCTVCIWTYLAAFIVNSICSV TLSNPQSSWDSYLLGANASRVSERKAKAVALVATTLRLYLVDGPWFFVMALFVLSCWVLRASFRDLEEKVTEDMSAE DVSRLKERYCQLTAVVNELDDNLSPSLFVWYVAVLVALCSRFSAIVTRTSHEVQIFWWLTHLLGLLWTLAILFGVS Supplementary Methods Selection of Ixodes scapularis Wikel strain for genome sequencing The Ixodes scapularis Wikel strain, established by Dr. S. Wikel (Quinnipiac University, Hamden, CT) was selected for genome sequencing. This colony was established in 1996 using approximately 30 pairs of field collected adult male and female ticks from New York, Oklahoma and a Lyme disease endemic area of Connecticut. At time of sequencing, the Wikel strain had been continuously in-bred from brother-sister crosses for twelve generations. Ticks derived from this colony have been found competent for transmission of Borrelia burgdorferi (strains B31 and 297) and Babesia microti isolates. Genome Size Prior to sequencing, flow cytometry was performed on propidium iodide-stained nuclei prepared from synganglia cells and used to estimate the haploid nuclear genome size of I. scapularis Wikel strain ticks as approximately 2.31 Gbp1. Construction of Genomic Libraries Construction of Small, Medium and Large Insert Genomic Libraries Total DNA was extracted from a single batch of I. scapularis Wikel strain embryos using Qiagen Genomic Tips GS-100 (Qiagen, Piscataway, NJ) according to manufacturer instructions. Embryos were surface sterilized in 10% bleach solution for 10 minutes prior to DNA extraction. Genomic DNA was used to construct small (~ 4 kb) and medium (10-12 kb) insert genomic, and large (40 kb) insert fosmid libraries at the J. Craig Venter Institute (JCVI) and The Broad Institute of Harvard/MIT. Construction of a Bacterial Artificial Chromosome (BAC) clone library An I. scapularis 10X BAC clone library with an average insert size of ~120 Mbp was produced by the Clemson University Genomics Institute (CUGI). The library comprised 184,320 independent clones which were arrayed to nylon filters. 32P-labeled I. scapularis genomic DNA was hybridized to the filters and used to identify clones with a high repeat content using published procedures2. Forty-five clones that failed to demonstrate a strong hybridization signal were selected for complete BAC sequencing and assembly (Supplementary Table 4). Genome Sequencing and Assembly Ixodes scapularis Nuclear Genome The genome of I. scapularis Wikel strain was sequenced in a joint effort by the Broad Institute and the JCVI and funded by the National Institute of Allergy and Infectious Diseases, National Institutes of Health (NIAID/NIH). Sequence data were generated by Sanger shotgun sequencing of the genomic libraries described above. Sequence reads were assembled with the Celera Assembler (CA) software, which is available as open-source (http://wgs-assembler.sf.net). The original version of the CA software3 had been modified to assemble at low sequence identity4, to report high quality SNPs and longer variants5,6, and to trim reads based on partial overlaps to other reads7. Running on Sanger data only, the I. scapularis assemblies did not use the CABOG unitig module developed for 454 pyrosequencing data7. An initial assembly was generated with CA version 3.1 before the completion of sequencing. Subsequent assemblies used CA version 4.0. The final assembly incorporated parameter settings and process modifications chosen to increase assembly contiguity on this data. The final assembly, labeled Assembly D in Supplementary Table 1, was deposited in GenBank as JCVI_ISG_i3_1.0 and has the VectorBase designation IscaW1. Analysis of reads. K-mer analysis indicated high polymorphism in these data, where K-mer is defined as K consecutive basecalls in a read. For a read of length N, M=N-K+1 is the precise number of K-mer instances and an upper bound on the number of distinct K-mer sequences. Each distinct K-mer sequence has some frequency F across all the reads. Distinct K-mers with F=1 are single-copy. Single-copy K-mers may be induced by sequencing error, low coverage across polymorphic loci, or low coverage in general. Single-copy K-mers are useless as alignment seeds. Celera Assembler uses K-mer matches to seed sequence alignments and thus to detect pair-wise read overlaps. At K=22, CA’s default, 50% of Ixodes’ distinct K-mers are single-copy and single-copy K-mers cover 12% of the data. Smaller values of K were required for sensitive overlap detection, especially in polymorphic regions of the genome. At K=16, the single-copy K-mers make up 25% of distinct K-mers and cover 2.6% of the data. K-mer analysis also indicated high repetitiveness in these data. An F value of 50 was considered high frequency for a K-mer in these data. At K=16, just 1.8% of the distinct K-mers displayed high frequency in the reads, but these K-mers covered 56% of the data. This indicated that larger values of K would be required for specific overlap detection, especially in repetitive regions of the genome. Obviously, there were compelling and competing demands on the assembly parameter, K. Trimming of reads. Reads were trimmed using CA’s overlap-based trimming (OBT). The initial assembly used CA defaults. The trimming was based on each read’s partial overlaps (local alignments) to other reads, where overlaps were discovered with the K-mer seed size K=22 using K-mers whose frequency in reads was greater than 1 and less than the frequency of the top 1% of most frequent K-mers. The software trimmed reads that (a) had a span confirmed by overlaps and (b) had some position at which overlaps consistently broke off. Analysis of the initial assembly uncovered anecdotal evidence of insufficient trimming. In an effort to improve trimming of this data, the later assemblies incorporated pipeline modifications designed to uncover additional partial overlap evidence. Assembly B was run with parameter changes that specified small seeds (K=16) and a low frequency threshold for seeds (freq<=50) at the default minimum overlap (length>=40). These parameters were chosen for high sensitivity among non-repetitive or polymorphic sequence. Assemblies C and D also incorporated large seeds (K=28) and high frequency threshold (frequency<=8000) with a large minimum overlap (length>300). These parameters were chosen for high specificity among repetitive sequences. Thus the OBT stage of assemblies C and D used the union of overlaps computed under two regimes. Celera Assembler’s chimer detection option was disabled during assemblies C and D because the ratio of partial overlaps per read seemed to induce over-calling of chimera. Overlaps and unitigs. Celera Assembler computed full overlaps between reads that shared a K-mer subsequence. Without changing the reads, the CA optionally corrected the observed error rate per overlap for all reads whose overlap collection indicated a correctable basecall error. It then filtered the overlaps by error rate and used the surviving overlaps to construct unitigs, or high-confidence contigs. Assemblies A and B used default settings, including 22-mer seeds, an alignment error threshold of 6% before correction, and 3% threshold after correction. Assemblies C and D used more permissive parameters: small K-mer seeds (K=14), a high frequency threshold for K-mers to use as seeds (frequency<=8000), and high tolerance for alignment error (mismatch<=20%). In assemblies C and D, 99.98% of the distinct K- mers were used as seeds, and the seeds covered 90% of the sequence data. The resulting overlap collection included 55 billion overlaps. In assemblies C and D, the correction option was disabled to avoid using high-error overlaps for correction. The unitig module was tested with several values of the overlap error rate filter and finally run with a permissive value (mismatch<=13%). Contigs and scaffolds. Celera Assembler built contigs and scaffolds from unitigs and the mate pairs that unitigs incorporated. Unitigs were evaluated by the A-stat statistic that compares observed to expected coverage3. Unitigs with high coverage, presumed collapsed repeats, were precluded from nucleating contigs but reserved for possible incorporation into multiple scaffolds later. For assembly D, the genome size was set explicitly (size = 1 Gbp) to a smaller-than-expected value, effectively increasing the expected coverage. The goal was to incorporate more unitigs early in the scaffold building process. Assemblies A, B, and C had used the default behavior in which genome size is estimated from the unitigs at run time. Assemblies A and B used default settings that allowed up to 6% error when merging unitigs into a contig, and up to 6% when recovering trimmed sequence from reads at contig ends to close a gap. Sequence analysis of contig ends in initial scaffolds indicated that polymorphism was preventing well-supported merges. In assemblies C and D, the error tolerance was increased to 20%. The CA consensus module failed on seven contigs, possibly due to accumulation of pair-wise error in the multiple sequence alignment. These seven alignments were inspected visually and adjusted slightly so as to permit continuation of the CA computation. Supplementary Table 1 captures the effects of our assembly interventions. Adding 1/3rd more reads after assembly A increased the sizes of the maximal scaffold and contig, but had little effect on total span or N50 values (compare columns A and B). Adjusting K and other overlap parameters greatly increased maximum, mean, and N50 values (compare columns B and C). The drop in total span of scaffolds and contigs was partly due to combinations of previously separate contigs. The result of adjusting the genome size parameter was to increase the mean and N50 for values for scaffolds while slightly decreasing them for contigs (compare columns C and D). Each successive assembly incorporated more reads into contigs. Assembly D incorporated 44% of input reads in contigs. Assembly D left 2.2M reads (13% of input) in unincorporated unitigs called “degenerates” and 7 M unassembled reads (42% of input) called “singletons.” Of the 15.6 M reads that had a mate constraint after trimming, assembly D scaffolds satisfied the constraint for 3.8 M reads (24%). The size and distribution of DNA on the IscaW1 scaffolds is shown in Supplementary Table 2. The longest scaffolds range from 1-4 Mb and comprise approximately 3.6% of the genome. Approximately 48.9% of the genome is represented by scaffolds ranging from 10-100 Kb and scaffolds of 10 Kb or less comprise approximately 23.6% of the genome. Sequencing, Assembly and Analysis of Ixodes scapularis BAC Clones Forty-five BAC clones selected from the I. scapularis 10X BAC library were shotgun sequenced and assembled (Supplementary Table 4). BAC sequence accession ranges are: AC192414-AC192429, AC192742- AC192744, AC200531, and AC205630-AC205654. More than 185,000 BAC clones were end-sequenced and trace reads are available at VectorBase (https://www.vectorbase.org/). The assembled BACs were aligned to the I. scapularis IscaW1 annotated scaffolds using Mummer (Supplementary Table 4; Supplementary Fig. 4). Of the 45 BACs, only 12 align to a single IscaW1 scaffold, six align with between two to four IscaW1 scaffolds, and the remaining BACs align to ten to more scaffolds. Analyses of BACs with multiple hits to IscaW1 scaffolds failed to identify any potential coding sequence. Repeat-rich regions were identified in assembled BACs utilizing an in-house repeat library built using RepeatScout. Of the 45 sequenced BACs, 21 are composed of low complexity regions and do not contain gene structure suitable for annotation (data not shown). Pfam genome alignments show that repeat associated domains are common and include extensin like, formin, reverse transcriptase, integrase, endo- exonuclease phosphatase, Pao, and PF00075, an RNase H domain for an enzyme involved in retroviral replication, that is often found in association with reverse transcriptase domains (data not shown). The most prevalent retroelement had the following arrangement of domains: PF03372 (Endo-Exonuclease phosphatase)- PF00078 (Reverse transcriptase)-PF00665 (integrase). Some element regions were found that lacked the PF03372 Endo-Exonuclease phosphatase domain, and less often the Integrase domain. To determine gene content in the BACs, homology searches were performed using protein databases (NR Genbank non-redundant database, Pfam domains, and annotated I. scapularis IscaW1 peptides), and I. scapularis EST data (Supplementary Table 5). The remaining 24 BACs contain various amounts of coding sequence. Ixodes scapularis Mitochondrial Genome The mitochondrial (mt) genome of I. scapularis was assembled from trace sequence. The genome assembly and manual annotations are available at VectorBase (https://www.vectorbase.org/). Phylogenetic analyses were performed to compare the I. scapularis mt genome to that of published mt genomes from other species of Ixodida and other arthropods. Supplementary Fig. 10 shows the organization of the mitochondrial genome of I. scapularis and comparison of mitochondrial gene arrangement between I. scapularis and other ticks and arthropods. Rickettsia Endosymbiont of Ixodes scapularis Analysis of I. scapularis trace reads revealed a substantial amount of reads comprised of bacterial DNA. Extraction of 16S rDNA sequences and subsequent comparative analysis with other bacterial species suggested that one organism with close affinity to members of the genus Rickettsia (Alphaproteobacteria: Rickettsiales) was simultaneously sequenced with I. scapularis. This organism was named Rickettsia Endosymbiont of Ixodes scapularis (REIS). The genome of REIS was assembled and annotated as a separate effort8. Briefly, ten previously sequenced Rickettsia genomes were used to recruit REIS reads from the I. scapularis read set, with subsequent scaffold recruitment and assembly yielding 109 contigs linked into one chromosome spanning 1.82 Mb. In addition, four rickettsial plasmids (pREIS1-4) were obtained. The annotated genome is available at GenBank (ACLC01000000) and PATRIC8. A rickettsial isolate cultured from I. scapularis ovaries was recently named as Rickettsia buchneri sp. and may be identical to REIS9. Among sequenced Rickettsia genomes, REIS is the largest to date (>2Mb) and contains 2,309 genes across the chromosome and four plasmids10. The 109 gaps in the assembly reflect the extremely high repeat nature caused by an extraordinary proliferation of mobile genetic elements (MGEs), which are dominated by >650 transposases (TNPs). TNP-mediated recombination events have resulted in dozens of pseudogenes, and also contribute to limited synteny with other Rickettsia genomes. An integrative conjugative element named RAGE (Rickettsiales amplified genetic element) is present on both the REIS chromosome and plasmids, encoding F-like type IV secretion system genes and many genes characteristic of the intracellular mobilome. The abundance of TNPs relative to genome size, together with the RAGEs and other MGEs that encompass ~35% of the genome, place REIS among the most repetitive bacterial genomes sequenced to date. Despite the proliferation of MGEs in the REIS genome, a typical core rickettsial genome was obtained, characteristic of reductive genome evolution as a consequence of an obligate intracellular lifestyle dependent on the utilization of host metabolites. Robust phylogeny estimation places REIS ancestral to the spotted fever group rickettsiae, containing the agent of Rocky Mountain Spotted Fever, among other pathogens. Ixodes scapularis Genome Annotation The annotation of the I. scapularis genome was performed via a joint effort between the JCVI and VectorBase. The genome annotation release IscaW1.2 is available at VectorBase and GenBank (accession ID: ABJB010000000). A total of 18,385 scaffolds (17,365 >10kbp and 1,020 <10kbp; ~5% of the assembled scaffolds) were annotated, containing 20,486 protein-coding genes, and 4,439 non-coding RNA genes. Supplementary Fig. 5 shows that the majority of I. scapularis expressed sequence tags (ESTs) map to scaffolds of 10 Kb or greater in length, thus providing justification for this approach. Ixodes scapularis gene, intron, and exon statistics are shown in Supplementary Figs. 1-3 and Supplementary Table 3 in comparison to those for multiple sequenced invertebrates. The JCVI and VectorBase annotation pipelines utilize complementary approaches; the former focuses on ab initio gene predictions, while the latter utilizes primarily similarity-based methods. Both pipelines were run independently and the resulting outputs were merged by JCVI into a single consensus gene set. Several iterations of merging and manual review were performed. Updates to the gene set are performed on a regular basis at VectorBase. Repeat Identification The I. scapularis genome sequence was masked for repeat sequence prior to annotation. Publicly available repeat sequences were obtained from GenBank and de novo repeat identification was performed by JCVI using RepeatScout11 and by VectorBase using RECON12. Repeat sequences were merged into a single library that serves as input to RepeatMasker13 to mask the genome (data not shown). J. Craig Venter Institute Gene Prediction Pipeline An initial set of I. scapularis protein predictions were generated using dipteran protein sequences obtained from GenBank and aligned to the I. scapularis genome sequence using the programs AAT14 and GeneWise15. The I. scapularis EST set comprising 193,151 EST and cDNA sequences was aligned to the genome sequence (Supplementary Fig. 5) and high quality alignments were used to produce automated annotations based on gene structure using the software package PASA16. ESTs were also used to evaluate and capture potential genes in small contigs that were not initially included in the annotated scaffolds. EST hits to small contigs that are not part of the annotated scaffolds typically represent transcripts derived from transposable elements such as non-LTR type elements and do not contain an open reading frame. Finally, the ab initio gene prediction programs Augustus17 and GeneZilla18 (formerly known as TIGRscan) were used to generate gene models. VectorBase homology-based gene predictions were then incorporated into JCVI database and the gene sets were subsequently combined using EVidenceModeler19. VectorBase Gene Prediction Pipeline The Ensembl pipeline20 was used to predict non-coding and protein coding genes based on mRNA, EST/cDNA and protein evidence. The supercontigs were masked with the repeat libraries described above. UniProt protein sequences21 were mapped to the I. scapularis supercontigs using the Genewise program15. Two gene sets were produced based on the taxonomic origin of the proteins: (1) a “targeted” gene set from I. scapularis proteins only, with strict criteria, and (2) a “similarity” gene set from the remaining proteins. In the “similarity” gene set, gene predictions were prioritized according to protein origin: genes based on phylogenetically close species were placed first on the genome, then non-overlapping models based on more phylogenetically distant species were added, and finally eukaryota- and metazoa-based gene models were used to fill in gaps. Independently, the I. scapularis EST and mRNA sequences were mapped to the supercontig sequences using the Exonerate program22, generating a third gene set. Finally, a fourth ab initio gene set was produced using the SNAP program23 and supercontig sequences, and retaining only those predictions containing a Pfam domain. The four gene sets were merged into a single gene set that was then subsequently combined with the JCVI gene predictions. Supplementary Figs. 1-3 show a comparison of haploid nuclear genome size (in Mb) to features associated with the coding fraction of the genome (gene/exon/intron number and length) for 12 sequenced arthropod genomes based on EnsemblGenomes release 12. While I. scapularis has the largest haploid genome of any sequenced arthropod, the gene number and length, exon number and length, and intron number and length statistics for I. scapularis are similar to those for other sequenced arthropods. Together, these analyses suggest that the genome size of I. scapularis reflects the accumulation of significant amounts of non-coding sequence. Sequencing of the Ixodes scapularis Transcriptome As part of this project, 183,834 I. scapularis EST sequences were generated by Sanger sequencing of a pooled I. scapularis stage and tissue library and are available at GenBank and VectorBase (ESTs accession range: EW781064-EW964897). The cDNA library was constructed from total RNA extracted from the following stages: I. scapularis embryos, blood fed larvae, nymphs blood fed for 1-3 days, fully engorged nymphs, unfed males, unfed females, and adult females blood fed for two, four and seven days. The majority of ESTs align to IscaW1 scaffolds ranging in size from 10-500 Kb (Supplementary Fig. 5). Gene Ontology Analysis of Ixodes scapularis Expressed Sequence Tags (ESTs) Methodology. The predicted protein sequence of the 24,925 I. scapularis gene models (protein coding and non-coding RNA genes) was downloaded from VectorBase (https://www.vectorbase.org/) in March 2012 and the program Blast2GO24 (http://blast2go.de) was used to predict functional classification for each sequence. The Blast2GO program performs a homology search against the NCBI non-redundant (NR) database and assigns sequence to one of three gene ontology categories (biological process, cellular component and molecular process). Statistical analyses were performed using default settings and pie charts showing assignment to predicted functional category (Supplementary Fig. 6) were generated using a cut-off minimum of 1,000 sequences. Blast2GO annotations were obtained for approximately 50% of the 24,925 I. scapularis predicted protein sequences. The majority of annotations were inferred based on similarity to sequences for I. scapularis and the tropical bont tick, Amblyomma maculatum, followed by sequences for Homo sapiens, Mus musculus and Pediculus humanus. The majority of GO classifications were inferred based on electronic annotation only. Blast2GO classified the I. scapularis sequences into thirteen “Biological Process” functional groups (Supplementary Fig. 6a). For the “Cellular Component” category, the program classified sequences into six functional categories, namely “cytoplasmic part”, “intracellular organelle”, “nucleus”, “intracellular non-membrane- bounded organelle”, “integral to membrane” and “protein complex” (Supplementary Fig. 6b). For the “Molecular Function” category, more than 50% of the sequences were classified as either “hydrolase activity”, “protein binding” and “transferase activity”, while the remaining sequences were classified as “zinc ion binding”, “nucleic acid binding”, “transposase activity”, “oxidoreductase activity” or “purine ribonucleoside triphosphate binding” (Supplementary Fig. 6c). Ixodes scapularis Gene and Genome Evolution Comparative Evolutionary Analysis of the Ixodes scapularis Gene Repertoire Molecular Species Phylogeny. To estimate the average rate of amino acid substitutions in the conserved cores of orthologs shared across multiple invertebrate and vertebrate species and to reconstruct the arthropod phylogenetic tree, single-copy orthologs from www.OrthoDB.org25 were selected from I. scapularis and 11 additional species, including the Crustacean water flea, Daphnia pulex, five insects: Pediculus humanus, body louse; Nasonia vitripennis, jewel wasp; Tribolium castaneum, flour beetle; Anopheles gambiae, malaria mosquito and Drosophila melanogaster, fruit fly; and five outgroup species: human, mouse, chicken, zebrafish and Nematostella vectensis (sea anemone), resulting in 524 Strict Single-Copy (SSC) Orthologous Groups (OGs), with one gene from each species. Multiple protein sequence alignments were performed with MUSCLE26 for each OG, and conserved well-aligned cores were extracted using GBlocks27 (>66% conservation, 100% flanking, maximum of 8 non- conserved positions, minimum block size of 4) resulting in 90,763 aligned amino acids, of which 67% showed variation. The phylogenetic tree was computed with PhyML28 employing the JTT substitution model, estimated proportion of invariable sites, four substitution rate categories, estimated gamma distribution parameter, empirical amino acid equilibrium frequencies, optimized tree topology search, branch lengths, and substitution model parameters, with 100 bootstrap replicates (Fig. 3a). Intron Evolution. The identification of introns in well-aligned sequence regions of single-copy orthologs across representative arthropod and non-arthropod species was performed in a manner similar to that employed in other studies29. 524 Strict Single- Copy (SSC) orthologous groups (OGs) were selected from www.OrthoDB.org25 with one gene in each of the 12 selected species (NVECT, Nematostella vectensis; HSAPI, Homo sapiens; MMUSC, Mus musculus; GGALL, Gallus gallus; DRERI, Danio rerio; ISCAP, Ixodes scapularis; DPULE, Daphnia pulex; PHUMA, Pediculus humanus; NVITR, Nasonia vitripennis; TCAST, Tribolium castaneum; AGAMB, Anopheles gambiae; DMELA, Drosophila melanogaster). A second, larger set of OGs was selected allowing no more than three paralogs in three species and selecting the longest protein per species, resulting in 1,529 Relaxed Single-Copy (RSC) OGs. The introns were mapped on to the protein sequence alignments, allowing for small splice site changes (one amino acid difference) [as observed in other studies30], and conserved regions with an intron in at least one species were identified by requiring >30% amino acid identity in the aligned blocks of five columns before and after the intron position, and no species with any missing sequence in the region, resulting in sets of informative intron positions in each species (Supplementary Fig. 11). From a total of 44,222 SSC and 135,216 RSC introns, between 32% and 52% of introns in each species are located in well-aligned core regions of the ortholog alignments and may therefore be compared across the 12 species. Using strict or relaxed orthologous groups (SSC or RSC) does not affect the proportions of informative introns. The non- arthropod species have the most introns, the Dipterans have the least, and ISCAP has the greatest number of introns and informative introns among the arthropods. Informative intron positions from the five outgroup species (NVECT, HSAPI, MMUSC, GGALL, and DRERI), and the five insects (PHUMA, NVITR, TCAST, AGAMB, and DMELA) were compared to ISCAP and DPULE to quantify shared and unique intron positions across all 12 species in the strict (SSC) and relaxed (RSC) sets of orthologous groups (Fig. 3b; Supplementary Table 7). Comparing the 18,987 SSC and 53,322 RSC informative introns identified 4,621 and 13,459 intron positions, respectively. Only 42 SSC and 113 RSC intron positions are conserved across all 12 species. Examining pairwise conservation of intron positions between ISCAP and each of the other eleven species shows the greatest sharing with the non-arthropods (NVECT, HSAPI, MMUSC, GGALL, and DRERI), about 3 times more than with AGAMB and DMELA, and about 1.5-1.8 times more than with DPULE, PHUMA, NVITR, and TCAST (Supplementary Table 8). To reconstruct the 12-species phylogeny based on conservation of intron positions, presence/absence matrices for the 4,621 SSC and 13,459 RSC intron positions across the 12 species were used to compute Euclidean distance matrices with 1000 bootstrap samples in R (Development Core Team 2011). These matrices were used to compute Unweighted Pair Group Method with Arithmetic Mean (UPGMA) and Neighbor Joining (NJ) trees using the neighbor program from PHYLIP31. The resulting trees were ordered and compared using the Newick Utilities32 to identify bootstrap support values for the consensus trees. Employing the intron presence/absence data as a phylogenetic signal successfully reconstructs the species tree from both the strict and relaxed sets of orthologs using both UPGMA and NJ algorithms (Supplementary Fig. 12). ISCAP consistently shows greater similarities to the outgroup species - vertebrates and the sea anemone - than to the pancrustaceans. To compute intron gain/loss estimates across the phylogeny, the presence/absence matrices for the 4,621 SSC and 13,459 RSC intron positions across the 12 species were analyzed using the MALIN suite for maximum likelihood analysis of intron evolution in eukaryotes33. Intron gain/loss rates were first optimized, and then presence/gain/loss estimates were computed with the Dollo Parsimony (DP) and Posterior Probability (PP) algorithms (Supplementary Fig. 13; Supplementary Table 9). The greatest numbers of losses are estimated to have occurred on the Pancrustacea branch, from 1.6-1.7 (DP) to 3.4-3.5 (PP) times more losses than on the Arthropoda branch. DPULE stands out as having a large number of intron gains, in agreement with results from the analysis of the D. pulex genome34. To compare lengths of introns among the 12-species, the base-pair lengths of all identified pairwise orthologous introns for the strict and relaxed sets between ISCAP and each of the other eleven species were collected from their corresponding General Feature Format files. Wilcoxon tests were performed in R (Development Core Team 2011) to evaluate statistical differences in length distributions between species (Supplementary Fig. 14; Supplementary Table 10). Examining the distributions of orthologous intron lengths shows that ISCAP introns are most similar to those of MMUSC and the other vertebrates, but more than an order of magnitude longer than introns shared with pancrustaceans. Orthology. Examining groups of orthologs delineated across 33 arthropod species from www.OrthoDB.org25 identified about a quarter of I. scapularis genes with recognizable orthologs in each of the representative species selected from six different arthropod lineages: Crustacea, DPULE, Daphnia pulex; Phthiraptera, PHUMA, Pediculus humanus; Hymenoptera, NVITR, Nasonia vitripennis; Coleoptera, TCAST, Tribolium castaneum; Lepidoptera, BMORI, Bombyx mori; and Diptera, DMELA, Drosophila melanogaster (Supplementary Fig. 9). A further quarter of I. scapularis orthologs are less broadly conserved across Arthropoda, with gene losses in other species resulting in more patchy phyletic distributions. Of the remaining genes with no identifiable orthology, about half exhibit homology (BLAST e-value <1e-05) to genes in the other six representative species or to other I. scapularis genes. Gene Duplications in Ixodes scapularis Protein clustering of arthropod genes was performed for I. scapularis and ten other arthropods, using reciprocal BLASTP and OrthoMCL clustering methods. Proteome sources for I. scapularis and two additional chelicerate species, three Crustacea, five Insecta and two vertebrate outgroup species, as available in 2011, used for these analyses are listed in Supplementary Table 11. To address a deficit of non- insect arthropod gene sets, two transcriptome datasets were included in the analyses, one for the dog tick, Dermacentor variabilis, and a second for the shrimp, Pandalus latirostris. Similar genes, measured with reciprocal best BLASTP were clustered using standard methods outlined for OrthoMCL35. OrthoMCL has practical advantages over related techniques in identifying orthology, and compares favorably in detecting true orthology36. In the present study, significance criteria were applied as per recommended options. Specifically, these criteria were a similarity p-value ≤ 1e-05, protein percent identity ≥ 40%, and MCL inflation of 1.5 (this affects granularity of clustering). Reciprocal best similarity pairs between species, and reciprocal better similarity pairs within species (i.e., recently arisen paralogs, or “in-paralogs”) were added to a similarity matrix. The matrix was normalized by species and subjected to Markov clustering (MCL) to generate orthology groups, including recent in-paralogs. One aspect of the OrthoMCL method that is important to the results is the fact that the program eliminates partial genes from clusters. Thus, short protein sequences that otherwise represent a family, were excluded. Computational analyses were performed to evaluate the contribution of gene duplications to the complement of I. scapularis genes and to explore the possibility of one or more whole-genome duplication events in the evolution of this species. Putative duplicated sequences (paralog pairs) were identified in the I. scapularis transcriptome using a method based on that of37. Briefly, 20,901 tentative consensus (TC) sequences, produced by alignment of 192,461 I. scapularis ESTs, were downloaded from the Dana Faber Cancer Institute – The Gene Index Project (compbio.dfci.harvard.edu/tgi) on February 19, 2008. The program getorf38 was used to identify all possible open reading frames (ORFs) for each TC sequence. The longest ORF for each sequence was selected using longorf and Vmatch (http://www.vmatch.de) was used to perform an “all- against-all” nucleotide sequence comparison of each ORF translated in six reading frames. Sequence pairs with at least 75% nucleotide similarity within a predicted open reading frame were identified as candidate paralog pairs. Predicted protein sequences for I. scapularis and other arthropods, as identified by OrthoMCL, are summarized in Supplementary Table 11. This table shows groups of genes clustered based on orthology groups (singletons or duplicates) and unique groups of paralogs. The number of orthology groups found in I. scapularis approaches that for insects, while the other two Chelicerate species, Tetranychus urticae and D. variabilis, have considerably fewer groups. The tabulation of missed orthology groups (OrMis1) is somewhat higher for the Chelicerata, with I. scapularis missing the fewest number of groups. This result may be either partly or entirely explained by shorter, partial genes that predominate in the datasets available for species of this clade. By comparing species protein sizes to the median size for each gene family, we found that I. scapularis has a -123 amino acid (aa) average difference, and 24% short outliers (2 standard deviations shorter), T. urticae has -25 aa, 10% short outliers, and D. variabilis has 75% short outliers (note that analyses were based on an artifactually incomplete transcriptome for this species). The Crustacea range from -80 aa to +10 aa average difference from the median, while the Insecta average above the median gene family size. While these results suggest that I. scapularis may be missing common gene families, the more likely interpretation is that the tick has fragmented, artifactually short genes, and the same may also be true for T. urticae. Analyses of the I. scapularis transcriptome revealed no signatures of large-scale gene duplication or entire genome duplication events. Nucleotide sequence comparison of the longest ORFs corresponding to each of the 20,901 unique I. scapularis TCs identified 4,786 putative paralog pairs, suggesting that approximately 22% of I. scapularis transcripts are derived from tandemly duplicated genes. This percentage is consistent with estimates of paralog content in the genomes of other organisms. For reference, paralogs are estimated to comprise approximately 10%, 15% and 20% of the total gene content of the yeast, Sachharomyses cerevisiae, H. sapiens and the roundworm, C. elegans, respectively39. An improved I. scapularis gene set assembled from RNAseq data is publicly available here: http://arthropods.eugenes.org/EvidentialGene/arthropods/deertick/ A summary document summarizing this improved I. scapularis gene set and other arthropod gene sets is available here: http://arthropods.eugenes.org/EvidentialGene/arthropods/Arthropod_Orthology_Compl eteness/ Analysis of Repetitive Sequences in the Ixodes scapularis Genome Identification of Tandem Repeats (TRs) in a Small Insert Ixodes scapularis Genomic Library The Tandem Repeats Finder software40 was used to analyze DNA sequences obtained from end-sequencing of a small-insert I. scapularis gDNA library described previously41 (Supplementary Table 12). Only end-sequences with a sum total of TRs >100 bp were included. TRs from both the 5’ and 3’ end sequences for each corresponding clone were summarized together. Identification and Analysis of Repetitive DNA in the IscaW1 Assembly Repeat sequences were identified with RECON12 and RepeatScout11, and collated into a library that was then used to mask the genome with RepeatMasker13. Ixodes scapularis Class I and II TEs were identified based on structural features and sequence similarities to other reported TEs (Supplementary Table 13), and are available for download from the TEfam database at: http://tefam.biochem.vt.edu. Miniature Inverted Terminal Repeats (MITEs). The repeat library IxRepeatlib022908fsa was used to run FINDMITE42 (no requirement of direct repeat; terminal inverted repeat at 12 bp with no mismatch, and MITE length was set at 100- 700 bp). The resulting candidates were used as query to run TEalign, which is a pipeline that runs BLAST against the I. scapularis genome, retrieves matching copies plus flanking sequences, and performs clustal alignments. TEalign results were used to manually assess whether each element is a MITE and to classify them, on the basis of clear boundaries shared by multiple copies, terminal inverted repeats, and target site duplications. After obtaining the initial list of MITEs using methods described above, multiple rounds of self-BLAST were performed to remove redundancy using a cut-off of overall 80% identity. The non-redundant MITEs are used as a library to perform RepeatMasker (-div 20). Run RepeatMasker output was used to count MITE copy number and % genome occupancy (Supplementary Table 13). RepeatMakser may overestimate the copy number of elements as one copy may be broken into multiple pieces. Relatively stringent FINDMITE parameters were used for these analyses and it is likely there are additional MITEs await annotation. LTR Retrotransposons. LTR retrotransposons were identified in the genome assembly and 45 BAC clones using both structure and homology-based approaches (Supplementary Figs. 7-8; Supplementary Table 13). LTR_STRUCT (Version 1.1)43 allowed the identification at the structural level. For the homology-based approach, the strategy defined by44 was employed with refinements45. Briefly, the canonical sequences of LTR retrotransposons from several insect genomes were recruited from Repbase46 and Tefam. TBLASTN47 was used to search for sequence homologous to the pol region of representative LTR retrotransposons in the I. scapularis genome. Those hits showing at least 30% amino acid identity over at least 80% of the length of the query sequence were subjected to further analyses to identify both LTRs of each element by means of BLAST2 sequences48. This first part of the strategy allowed the identification of canonical sequences representing complete copies that are putatively active and/or consensus sequences corresponding to those constructed after alignment of at least three complete copies of each LTR retrotransposon element in the tick genome. BLASTN searches47 were then performed using as query each one of the consensus/canonical sequences for each LTR retrotransposon element and providing a list of coordinates of putative each element in the genome. The final criterion used to define two copies as belong to the same LTR retrotransposon element was an identity of 80% or greater at the nucleotide level. Non-LTR Retrotransposons. Non-LTR transposable elements were identified using a homology-based approach, named TESeeker49. To classify the putative TEs obtained from TESeeker, BLASTN searches were performed with each putative TE and the top hit was identified. Next, the longest intact ORF was identified and analyzed using a “classifier.” The classifier operates as follows: a library of reverse transcriptase conserved domains (CD)50, 51 for insect non-LTR retrotransposons was used to classify the ORFs, and, in turn, the original hits. First, the longest ORF of the putative TEs was aligned using MUSCLE26 to the available CDs for the clade used to generate it. Next, the ORF was trimmed according to the average length of the CD for that particular clade. Only sequences that were at least 95% of the average length of the CD were trimmed and further analyzed. Next, the resulting putative non-LTR was aligned to the entire set of Class I CDs, again using MUSCLE, and an element was inferred from the maximum likelihood tree built from the previous multiple sequence alignment using PhyML52. A putative element was considered part of a clade if the branch length for that clade was less than 3.0 and the clade was the closest. To obtain the representation within the genome, TBLASTN searches were performed using the putative TEs as queries, each of which represented an element within the clade. Hits were counted if they were at least 80% identical to the query and were at least 40% of the query length (shown as “Copy Number” in Supplementary Table 13). Next, to estimate the total genome percent and total base pairs, an assumption was made for each element having intact conserved domains, that the reverse transcriptase was full-length. Knowing the average length of an element for each clade enabled extrapolation of the amount of base pairs for a full-length element, and it is recognized that this may produce an overestimate. Transposable Element Coding Sequences. A search of the I. scapularis genomic DNA for transposable element coding sequences was devised by (1) performing PSI-BLAST of the coding regions of representatives of the diverse families of transposable elements against the non-redundant database from NCBI; (2) constructing matrices from the alignments to be used by the tool RPS-BLAST; (3) retrieving genomic matches by RPS-BLAST against this database that were larger than 500 nucelotides (nt) and with an e value < 1e-15, with an additional 500 nt of flanking regions; (4) identifying terminal repeats (direct and inverted) and trimming the sequences accordingly (sequences without repeats were trimmed on their coding sequences); (5) clustering the data set of 7,461 elements having 90% identity over 90% of the sequence length to obtain 5,522 clusters of elements, then (6) comparing the consensus sequences to several databases by BLAST, and finally (7) running a program to classify these elements. The data were displayed on a hyperlinked excel spreadsheet from which any element, as well as the corresponding database matches, can be retrieved. The results are summarized in Supplementary Table 14. Several mariner and piggyBac elements were found containing a full length transposase without stop codon or frame shifts and having inverted repeats. The database is freely available from http://exon.niaid.nih.gov/transcriptome/I_scap_te/Is-te- web.xls and the FASTA file from http://exon.niaid.nih.gov/transcriptome/I_scap_te/is-te- JoseRibeiro-fasta.zip. Repetitive elements comprise a dynamic component of the coding and non- coding regions of eukaryotic genomes53,54 (Supplementary Tables 13-14). In addition to the 38 well-represented LTR retrotransposon elements identified in the Ixodes genome by means of a homology-based approach, we identified an extra set of 83 lower quality LTR retrotransposon elements in the I. scapularis genome assembly and 45 BAC clones by means of LTR_STRUC software, most of which probably correspond to remants of ancient mobilizations. Only 20 out of these 83 elements had intact or well- conserved ORFs that permitted further classification (Supplementary Table 13). The I. scapularis genome has a moderate amount of non-LTR retrotransposons (Supplementary Table 13). Most of these non-LTRs are non-functional, and have frame- shift mutations and indels. For those with a complete reverse transcriptase (RT) ORF, necessary for accurate classification, the CR1 clade contributed the most copies to the genome. The fact that a high number of distinct TE families were observed in the relatively young and evolutionarily close CR1 and L2 clades51,55 may be explained by the lack of a controlling mechanism within the I. scapularis genome, which allowed propagation and maintainance within the genome. Unlike other arthropods, the I. scapularis genome seems to lack a number of non-LTR clades such as R2, RTE, and LOA that are present in mosquitoes and Drosophila56,57,58,59. It is possible that these elements may have been present in the I. scapularis genome but may have been controlled and degraded, thus preventing their identification. A large number of non-LTR retrotransposons could not be classified to clade due to a low level of conservation and degradation of their RT ORF. For the purpose of this analysis, these elements were grouped into the “unclassified non-LTRs” category. Arrangement of DNA on the I. scapularis Chromosomes Physical Mapping Using Fluorescence in situ hybridization (FISH) Mitotic chromosomes were obtained from passage 31 of I. scapularis cell line ISE1860,61. Demecolcine (0.1 μg/ml) was added to the culture for 6-8 h to stop mitosis in metaphase and increase yield of chromosomes spreads for FISH. ISE18 chromosome preparations were held at -20˚C in fixative until use. Cot -1 DNA was prepared for I. scapularis according to previous protocols62 and used for FISH. Forty-five clones, corresponding to those fully sequenced and assembled herein, were selected from the 10X BAC library and grown in overnight cultures prior to BAC DNA isolation, according to2. FISH probes were prepared by labeling BAC DNA with either a biotin- or digoxigenin nick translation mix (Roche Molecular Biochemicals, Indianapolis, IN). Unincorporated nucleotides were removed from the samples with the QIAquick Nucleotide Removal Kit (Qiagen, Valencia, CA). A small insert (approximately 4 kb) gDNA clone library was prepared from sheared I. scapularis egg DNA (Wikel strain) using the TOPO PCR 4.0 cloning vector (Invitrogen, Carlsbad, CA)41. End-sequencing of a 384-well plate from this library was conducted at the Purdue University Genomics Core Facility, and the sequences are available at GenBank (Accession numbers GU318418–GU319109). Clones with end sequences comprised of at least 100 bp of tandemly-repetitive DNA, as identified with Tandem Repeats Finder software40, were selected for FISH experiments (Supplementary Table 12). Clones were grown in 5 ml of LB medium + antibiotic, and plasmid DNA was extracted using the QIAprep spin miniprep kit (Qiagen, Valencia, CA). Plasmid DNA was labeled and used for FISH according to published methods41. Probes based on the (TTAGG)n motif used to localize the telomeres were also constructed and the protocol for FISH and imaging processes was carried out as described previously2,41. FISH using I. scapularis Cot-1 DNA showed strong hybridization signals to the termini of nearly all chromosomes prepared from ISE18 cells (Fig. 2a). This pattern mirrored that observed with FISH probes for the ISR-2 tandem repeat family (95-99 bp repeat units) and high molecular weight HpaII-insensitive gDNA of I. scapularis, also believed to contain these same tandem repeats41. FISH using clones containing tandem repeats other than the ISR1-3 tandem repeat families were tested and these experiments showed several examples of tandem repeats that had prominent hybridization patterns dispersed among the presumed euchromatic regions of the chromosomes (Fig. 2c; Supplementary Table 12). A total of 45 clones from the 10X BAC library, representing those that were completely sequenced and assembled, were hybridized to ISE18 chromosomes (Supplementary Table 15). Fig. 2d-f depicts a representative example of these experiments, where a non-specific hybridization pattern was observed that is thought to reflect repeats dispersed among euchromatic regions of the chromosomes. Note that the terminal regions at one end of nearly all chromosomes are devoid of a hybridization signal to the representative BAC clone shown; this is the area to which the Cot-1 DNA- fractionated DNA hybridized (as well as the ISR-2 repeats and high molecular weight HpaII-insensitive gDNA of I. scapularis) and is thought to represent the centromere. Only three BAC clone hybridizations resulted in specific hybridization signals; these patterns matched that of hybridizations with markers for either the NORs or the ISR-3 tandem repeat family41. Analysis of the I. scapularis genome for signature telomeric sequences resulted in the discovery of a mixture of (TTAGG)n and (TTAGGG)n motifs in short stretches interrupted by other DNA sequences. This information agreed with previous findings63, where the (TTAGG)n telomeric motif was characterized by stretches <3 kb in the related tick, Ixodes ricinus. This feature of Ixodes species is in contrast with that reported in other arthropods typically having (TTAGG)n motifs in stretches of ~20 kb63. FISH hybridization of a (TTAGG)n probe to I. scapularis chromosomes showed a “two-spot” hybridization pattern at the termini of all sister chromatids of mitotic chromosomes (Fig. 2b)41. The position of the telomeric repeats relative to the nearly adjacent centromeric heterochromatin supports a telocentric (or acrocentric) chromosome structure, consistent with the original description of ISE18 chromosomes61. An ideogram (Fig. 2g) of I. scapularis chromosomes (2N=28 with an XX, XY sex determination system) was constructed based on the relative hybridization patterns of several tandem repeats to mitotic chromosomes prepared from cell line ISE1841,61. These repeats include a telomeric (TTAGG)n motif, the nucleolar organizing regions (NORs), and major repeat families ISR-1, ISR-2a, ISR-2b, and ISR-341. Physical mapping of these markers provided a basis to distinguish individual as well as several different groups of chromosomes. Those that can be readily distinguished include the sex chromosomes X (the largest) and Y (the smallest), as well as three pairs of chromosomes that hybridize to only ISR-1, ISR-2a, and ISR-2a + ISR-3, respectively. Also, an additional pair of chromosomes can be identified based on hybridization to ISR-2a over approximately half the entire chromosome. The other chromosomes in the karyotype were grouped according to their hybridization signals to these markers, but could not be reliably paired or distinguished from similar chromosomes. These groups include those that show signals for ISR-2a + NOR (4 chromosomes), ISR-1+ISR2a (4 chromosomes), and the remaining chromosomes that hybridize only to ISR-2a (10 chromosomes), respectively. This ideogram representing the current I. scapularis physical map serves as an anchor to position additional FISH markers as they are further developed. Ixodes scapularis Genes and Gene Families The Ixodes scapularis Sialome The saliva of blood sucking arthropods consists of a complex mixture of peptidic and non-peptidic compounds that disarm their hosts’ hemostasis, inflammation and immunity, thus helping blood feeding. Antimicrobial compounds are also commonly found, and these may protect the ingested meal from bacterial overgrowth, as well as protecting the feeding lesion in the case of hard ticks. While hematophagous insects have near one hundred salivary polypeptides identified from transcriptome analysis, saliva of hard ticks may contain several hundred polypeptides. Comparative transcriptome analysis of related arthropods indicates that salivary gland gene products are evolving at a fast pace, perhaps due to the immune pressure imposed by their hosts. Indeed, while salivary peptides can belong to ubiquitous protein families, unique salivary protein families are found at a genus and even subgenus level. These unique families probably derive from a gene common to the family or order ancestor but rendered unrecognizable by divergent evolution64,65. Gene duplications are commonly associated with salivary genes, even within insects having relatively compact genomes, such as the mosquito An. gambiae (~278 Mb, three pairs of chromosomes)54, where the uniquely Nematoceran D7 family consists of eight genes, and the uniquely anopheline G1 protein family has six genes66. In insects with larger genomes, or perhaps more importantly, larger number of chromosomes, such as the kissing bug Rhodnius prolixus (~600 Mb, 11 pairs of chromosomes)67, dozens of gene products coding for salivary lipocalins have been described, and are possibly derived from both gene duplication and genome duplication events68,69. In I. scapularis (~2.1 Gb, 14 chromosome pairs) 1,61, a large expansion of the lipocalin family (associated with anti-complement and anti- inflammatory activities), as well as proteins containing Kunitz domains (associated with serine protease inhibitory activity as well as channel blockers, functioning as anti- clotting and possibly as anesthetics or vasodilators)70,71,72,73 were identified, in addition to other gene expansions for numerous unique protein families74,75. Sialotranscriptome analysis based on ~8,000 ESTs from nymphs and adults at different stages of feeding led to the identification of 26 different groups of proteins (not including housekeeping proteins)74. Of these 26 families, 16 are either unique to ticks, or found only in the genus Ixodes, based on available sequence data64. When the deducted protein sequences were compared within a family, and a smaller than 90% sequence identity was used as a threshold level, 197 sequences were identified as possibly derived from individual genes (Supplementary Table 16); more closely related sequences are possible alleles or may derive from conserved gene duplication events. The large amounts of gene duplicates may provide a mechanism for antigenic variation, by differential expression of genes during the feeding process, as observed for I. scapularis cystatins76, while polymorphism may be maintained by frequency dependent selection of antigenic epitopes74. The availability of the draft genome of I. scapularis allows for verification of these salivary gene expansions and provides a platform for determining temporal and tissue specificity of these genes. In particular, it provides evidence for the large expansion of proteins with Kunitz domains, as well as for the apparent lack of genomic evidence for the expansion of unique protein families, such as the WC-10 family, or the anti- complement ISAC family. Kunitz-domain family. Seventy-four of the 20,452 annotated tick proteins possess one or more Kunitz domains (Supplementary Table 16), making the tick genome the richest source of proteins with this domain. Only 25 of the 46,704 human proteins, or 33 of the 26,255 bovine proteins have this signature as revealed by the KU Smart signature77 (Ensembl Proteome sets obtained at 7/31/2008). For comparison with insect proteomes the mosquitoes Aedes aegypti, Culex quinquefasciatus and An. gambiae have five, eight and four proteins respectively, with Kunitz domains (mosquito proteomes obtained from VectorBase in Dec/2009). Interestingly, no Kunitz domain- containing proteins were found in sialotranscriptomes of these three mosquitoes, but they occur in the sialomes of Culicoides78,79 and Simulium80, indicating a case of convergent evolution in the salivary recruitment of genes to assist blood feeding. Two I. scapularis proteins, Ixolaris and Penthalaris, containing two and five Kunitz domains, respectively, have been functionally characterized as potent inhibitors of the extrinsic pathway of blood clotting81,82. It is possible that this large family contain also channel blockers with toxic or vasodilatory properties, as recently identified for a Kunitz protein from a metastriate tick73. WC-10 and Isac families. The WC-10 protein family codes for mature proteins with masses near 10 kDa and a tryptophan-cysteine dipeptide motif at their carboxyterminus. Their function is unknown. Twenty-one members of the WC-10 family were identified in previous sialotranscriptome studies, but only four such proteins are found in the deducted tick proteome (Supplementary Table 16). Inspection of shotgun sequences indicates that some additional members of this family may be found, but not all. Similarly, four members of the Isac family of anticomplement proteins have been described, but only one protein of this family is found in the deducted proteome, coding for a protein that is only 65% identical to previously reported anticomplement proteins. Shotgun sequences, however, are found that code for three of the Isac proteins, indicating these may not have assembled into the genomic scaffolds. On the other hand, tick salivary proteins may be under strong evolutionary pressure imposed by their host’s immunity and thus may differ among geographical strains, which differed between the salivary EST and genome sequencing sets. Ixodes scapularis Innate Immunity/Tick-Pathogen Interactions Computational analysis to identify putative immune-related genes within the I. scapularis genome was performed using information available in GenBank83, VectorBase84,85, Ensembl86, and OrthoDB25. An extensive BLAST search (default parameters) was performed to identify sequences sharing homology with previously identified members from D. melanogaster, An. gambiae and Ae. aegypti. When multiple similar sequences were available for BLAST search, the longest isoform was used as a query. Sequences were then analyzed within Ensembl, OrthoDB and VectorBase to address gene prediction as orthologues and/or paralogues. Proteins sequences were also retrieved based on lists of significant BLASTp hits, and analyzed using Pfam87 and PROSITE88 for conserved domain identification. The results illustrated here (Supplementary Figs. 22-23) correspond to sequences obtained as orthologues for I. scapularis following subsequent manual curation. Retrieved I. scapularis sequences were further analyzed using PROSITE and the Conserved Domain Database for JAK- STAT domain identification89. Toll pathway. Our in silico approach identified four protein sequences annotated as peptidoglycan recognition receptors (PGRPs) (Supplementary Table 17; Supplementary Fig. 22a). However, our group did not assign a function to these genes, as PGRP isoforms may be categorized either in the Toll or the IMD pathways. We did not identify any Gram-negative binding protein (GNBPs). All bioinformatics comparisons using Drosophila GNBP1 or 3 as a query against the I. scapularis genome yield high e- values and no apparent functional correlation. Spaetzle processing enzyme (SPE) is a CLIP domain-containing serine protease. Multiple sequences could be found carrying CLIP and trypsin-like serine protease domains in the I. scapularis genome. However, their precise role is unclear. Modular serine protease (ModSP) and Grass leads to SPE cleavage. ModSP carries four low-density lipoprotein-receptor class A domains and a complement control protein (CCP) module. We did not identify any sequences carrying both domains. Grass, which shows a trypsin-like serine protease characteristic domain, shares similarity with several secreted salivary gland peptides (e-values < 1e-45). However, further studies are needed to properly identify a precise Grass and persephone counterpart in I. scapularis. We identified ten Toll sequences in the I. scapularis genome. Five of these sequences encode for either the characteristic Toll/Interleukin-1 receptor (TIR) or Leucine Rich Repeats (LRR) domains, but not both. An I. scapularis homologue of the adaptor molecule myd88 was uncovered, as well as homologues containing Death domains (DD) characteristic of the Pelle-Tube complex. We have also identified an embryonic polarity Dorsal homologue and a Cactus-like inhibitor of IB carrying ankyrin repeats. Similar to what has been described in mosquitoes90,91 we did not observe any homologue of the NF-B factor dorsal-related immunity factor (DIF). IMD pathway. Our in silico approach failed to identify a significant number of molecules involved in the IMD pathway (Supplementary Table 17; Supplementary Fig. 22b). Diaminopimelic (DAP)-type peptidocglycan (PGN) recognition leads to intracellular signaling through the adaptor molecule IMD, a DD-containing adaptor molecule that interacts with the PGRP receptors and triggers association of Fas-associated protein with DD (FADD). We did not observe any IMD or FADD homologues in the I. scapularis genome. These results can be explained by either a high degree of gene dissimilarity between species (i.e., IMD was also not identified in the louse92 and pea aphid genome93), or these sequences were not represented during I. scapularis genome assembly). Furthermore, the large evolutionary distance between ticks and dipteran insects made it challenging to uncover genes using homology-based methods. By searching the I. scapularis genome for DREDD-like caspases, we uncovered six caspases, four of which are annotated as “caspases” in VectorBase and Genbank. Two other sequences were also identified but are annotated as caspase-2 and 3. The cleavage of IMD exposes an inhibitor of apoptosis binding motif to allow recruitment of inhibitor of apoptosis proteins 2 (IAP2). We uncovered an IAP2 homolog in I. scapularis. In Drosophila, DIAP2 interacts with IMD and leads to IMD K63-ubiquitination. This ubiquitination involves Uev1a, Ubc13 (also known as Bendless) and Ubc5, or Effete. Our analysis indicated that these enzymes are highly conversed in the I. scapularis genome. Polyubiquitination of IMD seems to be essential for recruitment activation of the downstream Transforming growth factor β–activated kinase 1 (TAK1) and the IκB kinase (IKK) complex, as well as for binding of TAB2 (TAK1-binding protein 2). We identified I. scapularis homologues of TAK1, TAB2 and the IKK complex. Once IKK complex is activated by TAK1, it phosphorylates relish, a bipartite NF-B protein that has both a Rel homology domain and IB-like ankyrin repeats. A relish orthologue was successfully uncovered in the I. scapularis genome. Similarly, the negative regulators Plenty of SH3 domains (POSH), Caspar and Caudal were also observed in the I. scapularis. Recently, akirins have emerged as another nuclear factor regulating immune responses in parallel with NF-B in mice and in the context of the IMD pathway in Drosophila94. We have also identified an akirin homologue in I. scapularis – subolesin95. JAK/STAT. Candidate orthologues for all three core members of the JAK-STAT pathway (e.g., receptor, JAK kinase, and STAT activator) were identified along with putative orthologues for the following regulators: suppressor of cytokine signaling (SOCS) and protein inhibitor of activated STAT (PIAS) (Supplementary Table 17; Supplementary Fig. 23). RNAi pathway. The RNAi pathway is found in many eukaryotes96,97. Generally, the RNAi pathway can be categorized in two main signaling cascades: the siRNA (short-interfering) and the miRNA (micro) networks. The siRNA pathway is activated in response to endogenous or exogenous dsRNAs (double stranded) and has been associated with defense against viruses and transposable elements. Conversely, the miRNA cascade is only activated in response to endogenous dsRNA and differences in target mRNA complementarity may affect the final post-transcriptional gene silencing (i.e., mRNA cleavage or translation arrest)98,99,100,101. In the Drosophila siRNA pathway, the RNaseIII-like Dicer-2 enzyme cleaves a long dsRNA into a small 20-25bp dsRNA molecule. R2D2, a RNA-binding protein, interacts with Dicer-2 to promote loading of a now single-stranded siRNA into a RNA-inducible complex (RISC). A major component of RISC is the RNase-H enzyme Argonaute, which degrades the target mRNA, complementary to the sequence encoded by the antisense siRNA, and promotes gene silencing. We have identified two Dicer homologues in the I. scapularis genome (Supplementary Fig. 23b). We did not identify a homologue for R2D2. However, five sequences sharing homology with Argonaute were discovered in the genome. Recent studies have indicated the RNAi antiviral response is extremely complex in invertebrates, and an increasing number of molecules have been implicated in this pathway, controlling production of a range of virus-derived small RNAs. A list of other I. scapularis homologues is provided in Supplementary Table 17. Other immune-related genes. We identified homologues of several immune- related gene in the I. scapularis genome (Supplementary Table 17) but the precise pathway controlling their expression cannot be predicted solely by comparative genomics. Differential expression of antimicrobial peptides (AMPs) after infection, particularly, corresponds to a key component of immunity in Drosophila and mosquitoes. While Drosophila has seven AMP families, each one having several members, we identified only defensins and defensin-like molecules in I. scapularis. In mosquitoes, families of defensins and cecropins are the most predominant AMPs and they are represented by multiple members102. In a more extreme case, extensive searches in the pea aphid genome failed to identify any AMPs93. Our bioinformatics analysis confirmed the presence of genes previously annotated as AMPs: defensin, scapularisin, microplusin and two unnamed AMPs. Based on a more robust computational approach, a recent publication has suggested an expansion of the defensin family in I. scapularis genome103. We were unable to find in the I. scapularis genome any gene sequences sharing similarity with attacin, diptericin, drosocin, drosomycin or cecropin. Other important homologues uncovered include the enzymes Dual and NADPH oxidases, which control production of reactive oxygen species, and lysozymes, fibrinogen-related and thio-ester containing proteins, all of which contribute to the immunological process upon microbial infection. Ixodes scapularis Mevalonate-Farnesal Pathway Genes A BLASTX and BLASTN search of the I. scapularis genome for the insect enzymes involved in the synthesis of juvenile hormone (JH) III revealed the presence of all but two of the enzymes involved in the farnesyl-PP pathway (Supplementary Fig. 18; Supplementary Table 18). The genes found were acetoacetyl-CoA thiolase, hydroxymethylglutaryl-CoA synthase, hydroxymethylglutaryl-CoA reductase, mevalonate kinase, phosphomevalonate kinase, diphosphomevalonate decarboxylase and farnesyl diphosphate synthase. Shown are the I. scapularis supercontig numbers and gene accession numbers. The top insect BLAST results from these I. scapularis messages had e-values ranging from 1e-44 to 0.0. Isopentenyl diphosphate isomerase and geranyl diphosphate synthase were not found. Transcripts for all but two of the enzymes involved in this pathway have been found in the adult synganglion transcriptomes of the hard ticks, I. scapularis and the American dog tick, D. variabilis, and only one missing from the soft tick, Ornithodoros turicata. In the insect JH III branch (Supplementary Fig. 18), only two enzymes were found in the I. scapularis genome, farnesol oxidase and methyl transferase (MT), the former also found in the I. scapularis and D. variabilis synganglion transcriptomes and MT in all three synganlion transcriptomes. The farnesol oxidase transcript has the classic SDR family motif and shares 60% identity with the pollinating wasp, Ceratosolen solmsi marchali (e-value, 1e- 99). MT with a top BLAST hit for JH MT from the insect, Schistocerca gregaria (e-value, 4e-18) was found (Supplementary Table 18). Whether this enzyme functions as a JH MT in ticks is not known. There has been a large expansion of the MT gene family (Supplementary Fig. 19). It appears the MTs in I. scapularis examined so far do not have a JH binding domain. Farnesyl diphosphate pyrophosphatase, farnesal dehydrogenase and JH epoxidase were not found. JH epoxidase in insects in the P450 family CYP15A1 is responsible for the addition of the C10-11 epoxide to methyl farnesoate to produce JH III; this family of P450s was not identified in the I. scapularis genome. Biochemical studies of tissue extracts further support the hypothesis that ticks lack JH. In published work104, radio HPLC was unable to detect methyl farnesoate, JH I, JH II, JH III, or JH III bisepoxide in different tissues, including the synganglion of the soft tick (Ornithodoros parkeri) and the hard tick (D. variabilis) at different stages of development; the lower detection limit for JH and methyl farnesoate in these studies in the synganglion was 1.3 fmol for 10-tick equivalents in a 3 hour incubation. In the same study, no JH I, JH II, JH III, JH III bisepoxide, or methyl farnesoate was detected in adult hemolymph at the time of egg development in the same ticks as determined by EI GC- MS; the MS sensitivity was 1.6 pg in the scan mode from 40 to 300 AMU and 750 fg in the SIM mode for fragments at m/z 76 and 225. The same study failed to identify any lipid soluble material from whole body extracts of eggs, larvae, nymphs and adults of D. variabilis that would result in the retention of larval characters in the Galleria moth bioassay. The lower detection limits for eggs, larvae and nymphs were 28 pg for JH I and JH II and 980 pg JH III per g of tick tissue. For adults, the detection limits were 116 pg for JH I and JH II and 4069 pg JH III per g tissue. To date, JH has only been found in insects and only methyl farnesoate in the sister group to insects, the Crustacea. Finally, published work105 does not support the hypothesis that ticks regulate egg development via JH106 in D. variabilis; ecdysteroids initiated the synthesis of vitellogenin in D. variabilis but not JH III. Most evidence to date suggests that JH is not produced in ticks and that JH is not involved in tick metamorphosis and reproduction. The discovery of most of the farnesyl-PP (mevalonate) pathway and two enzymes, farnesol oxidase and methyl transferase, in the farnesal (insect JH) branch in both the I. scapularis geneome and adult syngnalion transcriptomes studied suggest these pathways are involved in reproduction at least and warrants future research in the potential role of these enzymes in the endocrinology and regulation of tick development. Ixodes scapularis Heme Synthesis and Storage Protein Genes To identify genes coding for enzymes in the heme pathway, heme biosynthesis genes from a range of animals, fungi and prokaryotes, including multiple Rickettsia species were used in TBLASTX similarity searches of the I. scapularis assembly (ABJB010000000) and trace files and the REIS assembly10. Genes were manually annotated using Artemis software (v.11, Sanger Wellcome Trust) (Supplementary Table 20). To provide further support for functional predictions additional curation of each gene model was facilitated based on E.C. number. Putative hemelipoglyco-carrier protein (CP) genes were identified via TBLASTN search of the I. scapularis ISCW1 assembly at VectorBase using sequences from the tick, D. variabilis107 and other invertebrates (Supplementary Table 22). Gene models were manually annotated using Artemis software v.8108 and corresponding accession numbers were identified, where possible. Adaptation to hematophagy has developed multiple times within the Arthropoda and even within a particular group such as the Diptera109,110. Despite the abundance of heme from the host hemoglobin, triatomine bugs (Order Hemiptera: Family Triatominae) apparently have the ability to synthesize heme as evident by the functional expression of delta-aminolevulinic acid dehydratase, the rate limiting enzyme in the heme biosynthetic pathway111. However, investigators were unable to demonstrate heme biosynthesis in the southern cattle tick, Rhipicephalus microplus111. Several steps in the heme biosynthesis pathway were found in the I. scapularis genome (Supplementary Fig. 15; Supplementary Table 20). In the light of these findings, the question of the role of heme biosynthesis enzymes in the processing of host blood versus de novo heme synthesis should be re-examined. In addition, the importance of these processes compared to heme sequestration by unique heme-binding proteins in ticks as described below, requires further evaluation. An important adaptation that co-evolved with blood feeding is heme sequestration by heme-binding proteins along with heme excretion, both of which prevent oxidative stress and tissue damage. Free heme results in reactive oxygen that leads to lipid peroxidation and cytotoxicity112. Heme is also important as a prosthetic group for respiration, enzymatic detoxification and oxygen transport113. In Rhodnius prolixus, host hemoglobin is digested to free heme which is then absorbed into the hemolymph and sequestered by a 15-kDa heme-binding protein (RHBP), reducing lipid peroxidation114,115. Other heme-binding proteins present in R. prolixus include nitrophorins for nitric oxide transport116 and which have been implicated in host vasodilation during blood feeding. This suggests multiple uses for heme and heme binding proteins in blood feeding insects and possibly in other organisms like ticks. Two storage proteins are found in tick hemolymph, a heme lipocarrier protein (CP) and the yolk protein (Vg), which share a common evolutionary origin107,117 . These proteins have similar structural motifs that include the LPD_N, the C-terminus vWD, the unknown function DUF1943 domain, cleavage sites (RXXR) and the GL/ICG domain (Supplementary Fig. 16). CP in hard ticks is found in both sexes and in all developmental stages and tissues studied. All CPs studied are composed of two subunits, 92 and ~100 kDa. Research suggests that the main source of CP mRNA in D. variabilis is the fat body and the salivary gland107. They also showed that host attachment and blood feeding initiated CP expression in virgin females while mating and feeding to repletion reduced the level of CP protein. Potentially, 10 CPs were found in the genome of I. scapularis (Supplementary Table 22), although all but one are incomplete gene models. This is by the far the greatest number of CPs found from a single tick species. It is not clear whether these genes are expressed, and if so, the importance of their protein products in tick physiology. The regulation of full-length yolk protein messages was studied in the hard tick, D. variabilis. Studies showed that DvVg1 and DvVg2 are exclusively expressed in females after mating and feeding to repletion and are up-regulated by ecdysteroids not JH III. Both Vgs are not expressed in males (fed and unfed) or females before mating and feeding to repletion. The main source for DvVg1 and DvVg2 is the fat body and the gut cells. In the soft tick, O. moubata, studies have shown that the source of OmVg is the fat body and the gut and is regulated by ecdysteroids similar to the case in D. variabilis118. The same study observed a major difference between D. variabilis and O. moubata, where in the latter, Vg expression was initiated by engorgement in both virgin and mated females but increased further in mated females. Multiple incomplete CP gene models and two Vg genes were identified in the genome of I. scapularis (Supplementary Table 22). The alignment of these sequences with homologous sequences from D. variabilis is shown in Supplementary Fig. 16. The conceptual CP proteins are similar in amino acid length and have the characteristic domains (LPD_N, DUF1943, vWD, RXXR and GLCG). The N-terminus sequence for the small subunit is FEVGKEYVY which is 100% identical to that determined for the R. microplus CP119. This sequence is directly downstream from the secretion signal and marks the start of the LPD_N domain. The N-terminus of the larger subunit is DASAKERKEIED which has high sequence similarity to the R. microplus CP119 and exists directly downstream from the only predicted cleavage site. The tick Vg genes contain three domains (LPD_N, DUF1943 and vWD). Additionally, the RXXR cleavage site may be absent, as is the case for the I. scapularis Vgs, or variable in number and locations as observed for Vgs from other tick species. In ticks, Vg proteins typically consist of several subunits with variable N-terminus sequences while CPs consist of two subunits produced by only one RXXR cleavage site. We also found that all tick Vgs have an amino acid spacer (10-20 amino acids) between the secretion signal and the LPD_N which does not exist in CPs. The high level of sequence similarity observed between tick CPs and Vgs complicates the characterization of these molecules. Ixodes scapularis Blood Digestion Genes Unlike most other blood feeding arthropods, ticks digest the protein contents of a blood meal intracellularly in the epithelial cells of the midgut. Hemoglobin liberated from hemolyzed erythrocytes binds to clathrin-coated pits on the luminal sides of the midgut epithelial cells and is internalized by pinocytosis into large (3-12 µm) endosomes (Fig 1D). Once inside the epithelial cells, the endosomes fuse with lysosomes to form specialized digestive vesicles. All hemoglobin digestion occurs intracellularly in these digestive vesicles and is carried out by a cascade of proteolytic enzymes, most functioning at acidic pH (3.5-4.5 pH, the pH optimum of the digestive vesicles). These enzymes selectively target different sites on the globin moieties, ending in dipeptides and free amino acids. The enzymatic steps previously described for Ixodes ricinus120 are believed to be the same or similar in I. scapularis, since the same enzymes occur in the I. scapularis genome (Supplementary Table 21). Similar hemoglobinolytic enzymes have been found in other tick species121,122, indicating that this novel mode of hemoglobin digestion is widespread throughout the Ixodida. Digestion of the globin moieties is initiated by the aspartic protease cathepsin D (the major hemoglobinase), assisted by the cysteine class endopeptidases cathepsin L and legumain. The action of these enzymes liberates heme and large (approximately 8 – 11 kDa) peptides peptide fragments. In the next stage of the process, the large peptides are digested further by the cysteine amino cathepsin B and the cysteine carboxypeptidase cathepsin L, cleaving them further into smaller fragments, ~5-7 kDa. The third stage in the digestive process is carried by cathepsin C, assisted by Cathepsin B, resulting in small (approximately 3-5 kDa) peptides. The final stage in the process is completed by serine carboxpeptidases (SCP) and leucine aminopeptidases (LAP) resulting in dipeptides and free amino acids. The latter are transcytosed from the digestive cells into hemolymph. Heme liberated from the digestion of the parent molecule is transported from the digestive vesicles by heme-binding proteins to hemosomes, unique storage vesicles where the heme is detoxified by forming unique hematin-like aggregates123. Hemoglobinolysis in ticks shows greater similarity to the enzymatic pathway in endoparasitic flatworms and nematodes than to blood feeding insects, although ticks are unique in carrying it out intracellularly within digestive vesicles of the midgut epithelium120,124,125. Ixodes scapularis Metabolic Detoxification Genes Ixodes scapularis cytochrome P450 (CYP450) annotations (Supplementary Table 23) were produced from the JCVI version 0.5 (133 sequence pieces) and VectorBase version 0.5 (195 sequence pieces) gene model predictions. BLAST comparison of these two gene model sets was used to produce a set of 223 unique CYP450 sequences. DNA sequence for each P450 was recovered from the WGS section of NCBI and each gene was assembled manually based on comparison to the closest matches from other tick, mite and insect CYP450 sequences. EST searches were also used to confirm intron-exon boundaries and to extend partial gene models. Phylogenetic trees were constructed with the most closely related sequences to assign CYP names based on established CYP nomenclature. Comparison of Ixodes P450s to Tetranychus urticae showed only Halloween gene families CYP302, CYP307, CYP314, CYP315 and the 26-hydroxylase that degrades ecdysteroids CYP18 are conserved (Supplementary Fig. 17). CYP306 is missing in both species. Putative carboxylesterase (EC 3.1) and acetylcholinesterase (AChE)-like (EC. 3.1.1.7/3.1.1.8) genes were identified in the I. scapularis genome seqeunce by TBLASTN search of scaffolds at NCBI (Supplementary Table 24). Gene models were manually annotated using Artemis v.8108 and the putative function of conceptual protein sequences was predicted based on protein sequence homology to invertebrate and vertebrate protein sequences. To identify divergent members of the carboxylesterase gene family, reciprocal TBLASTN searches were conducted against the ISCW1.1 assembly using the predicted I. scapularis carboylesterase and AChE-like protein sequences. Two hundred and six CYP genes and six pseudogenes were identified in the I.scapularis genome (Supplementary Table 23). Ninety-one additional fragments were also identified that were too short to name; some of these fragments may represent pseudogenes. This finding represents the largest number of CYP genes identified in any animal to date. The I. scapularis CYP18, CYP302, CYP307, CYP314 and CYP315 gene products may be involved in ecdysteroid metabolism, based on the function of orthologous genes in other invertebrates. The function of the remaining I. scapularis P450s is unclear. By comparison, the body louse, P. humanus, which like I. scapularis is also exclusively hematophagous, has only 36 CYP genes. It is unlikely that the large number of I. scapularis P450 genes reflects a need to detoxify blood components such as heme. One possible explanation for the expanded number of CYP450s in I. scapularis is exposure to plant toxins secreted as oils by plant trichomes. Ixodes scapularis spends much of its life cycle off host and may be exposed to a wide variety of plant chemicals, especially as it exploits vegetation in order to locate and transfer to its animal hosts. A total of 75 putative carboxylesterase/AChE-like genes, 11 putative pyrethroid metabolizing carboxylesterases with sequence similarity to the R. microplus CzEST9 gene which is associated with pyrethroid resistance in the cattle tick126, and two putative juvenile hormone esterases were identified in the I. scapularis assembly (Supplementary Table 24). Analyses suggest that the majority of these gene models represent complete or near complete CDS. However, some sequences listed in Supplementary Table 24 likely represent one or more exons of incomplete gene models. Further annotation, coupled with wet lab analyses will ultimately resolve the final number of carboxylesterase-like genes in the tick. Of note, many members of the carboxylesterase-like gene family are located on the same scaffold, with two extreme cases being scaffolds DS818569 and DS921995, both of which contain ten putative carboxylesterase gene models. This finding suggests significant tandem duplications, a phenomenon commonly associated with this gene family. Ixodes scapularis Neuropeptide Genes Identification of the neuropeptide genes was based on Blast searches utilizing gene sequences available in VectorBase. Where possible, additional evidence for some of these neuropeptides derived from transcriptomes; immunohistochemistry data for other ixodid tick species was also included, further supporting their functional assignment. A search of the I. scapularis genome for neuropeptides and neuropeptide receptors of the classical invertebrate neuroendocrine system revealed the presence of at least 39 canonical neuropeptide genes (Supplementary Tables 25-28). Twelve additional novel putative neuropeptide genes were identified from their tandem repeats with conserved C-terminal sequences including the canonical sequences for amidation and dibasic (or monobasic) cleavage signals (Supplementary Table 25). Canonical predicted neuropeptides include multiple allatostatins, myoinhibitory peptides, allatotropin, bursicon α, bursicon β, crustacean cardioactive peptide, CCH, corazonin, diuretic hormone, FMRFamides, eclosion hormone, glycoprotein hormone α/β, insulin- like peptide, neuroparsin (insulin-like growth factor binding protein or IGFBP), ion- transport peptide, orcokinin, sulfakinin, prothoracicotropic hormone (PTTH)-like hormone, proctolin, pyrokinins, periviscerokinin, SIFamide and tachykinin. Ticks are chelicerates, a subphylum that evolved more than 500 million years ago127, and are evolutionarily distinct from the insects and crustacea. Ixodid ticks are unique among blood feeding arthropods in their ability to feed for long periods, create additional cuticle to accommodate enormous blood meals, and remove excess blood meal water via their salivary glands. Blood feeding also stimulates development and reproductive functions. Here we review genes for neuropeptides believed essential to these processes. Among the most abundant of these neurohormones is allatostatin (Type A). The gene ISCW022937, a likely ortholog of the cockroach allatostatin precursor (AAC72892), was found in the tick genome database, but its function has not been determined. Three copies of the gene for an allatostatin receptor were also identified. Allatotropin and allatostatins regulate production of juvenile hormone (JH) in insects and may have additional functions as well; however, there is no conclusive evidence of JH in ticks104. Consequently, the function of these peptide hormones and/or their receptors in ticks is enigmatic. Evidence of allatostatin mRNA was found in the synganglion of the dog tick, D. variabilis128 and I. scapularis129, suggesting that this hormone and its receptor may be conserved throughout the Ixodida. The gene for allatotropin was found in the I. scapularis genome and evidence of a transcript predicting its occurrence in the synganglion of adult I. scapularis was reported129 and also demonstrated by immunohistochemistry in Rhipicephalus appendiculatus130. These peptides may also have other regulatory functions. In insects, allatotropin was shown to stimulate the foregut muscles, whereas allatostatin was found to inhibit contractions of the foregut, and, as a result, suppressed feeding activity131. Consequently, the role of these genes in I. scapularis awaits further biochemical and molecular studies. Genes associated with the ecdysial process were found, including corazonin, eclosion hormone, CCAP, and bursicon (α and β). In addition to the complete gene model of corazonin in the I. scapularis genome, ESTs matching corazonin and the corazonin receptor were identified in an unpublished synganglion cDNA library from adult female D. variabilis128; and this neuropeptide was also detected in unfed adult female R. appendiculatus by immunohistochemistry130. Similarly, a match for eclosion hormone (ISCW001941) to a conserved hypothetical I. scapularis protein (NCBI XM_002399230) was found. Expression of these hormones and/or hormone receptors was reported in adult female D. variabilis by 454 pyrosequencing128. Genes for both bursicon α and bursicon β were identified. Transcripts for both bursicon subunits were also found in the synganglion of feeding adult female D. variabilis128. Bursicon is an approximately 30 kDa, highly conserved molecule in insects where it functions in wing expansion (in Drosophila) and as a cuticle-hardening (tanning hormone) regulator132. Although adult female ixodid ticks do not molt again after nymphal eclosion, they do secrete new cuticle during feeding and it is likely that these genes contribute to hormonal regulation of cuticle hardening and tanning. Insulin-like peptide (ILP), a member of the insulin superfamily, is a highly conserved gene that is widespread among multiple taxa. Following transcription, it is translated as a preprohormone. In insects, following cleavage of the signal peptide, the mature proteins containing the characteristic A, B, and C-chain peptides are stored in secretory granules. Subsequently, the C peptide is removed by convertase. Genes for preproconvertase (ISCW020499) and IGFBP (ISCW003285) were found in the I. scapularis genome, suggesting the existence of an insulin signaling pathway. Insulin- like signaling activity is believed to regulate development, longevity, metabolism, and female reproduction133 as well as ecdysteroidogenesis134. Silencing IGFBP (by RNA interference) prevented blood-feeding females from feeding to repletion, indicating the role of this protein in regulating feeding in ticks135. ILP mRNA was found in the transcriptome of the female D. variabilis synganglion and ILP immunoreactivity has been identified in other tick species130,136. ILP is believed to be secreted from neurosecretory sites in the periganglionic sheath into the periganglionic sinus and thereupon into general circulation. Orcokinins and sulfakinins are believed to be important in regulating contractions of the digestive tract in insects and are likely to play a similar role in I. scapularis. Orcokinins increase gut contractions, presumably enhancing feeding activity, whereas sulfakinins inhibit feeding activity. At least one orcokinin gene and two sulfakinin isoforms were identified in the genome. Transcripts of four orcokinins, a preprosulfakinin and a sulfakinin receptor were found in the transcriptome of the female D. variabilis synganglion128. Sulfakinins show homology to cholecystokinins, which are believed to function as satiety inducing peptides137. We hypothesize that the sequential up or down regulation of these genes following mating induces rapid blood feeding to repletion. Several genes were found that are important in regulating salivary gland function. In addition to dopamine, long known as a secretory agonist138, myoinhibitory peptide (allatostatin B) and SIFamide peptide were identified in the I. scapularis genome. These peptides were also identified in neurosecretory cells and their axonal projections leading to the salivary glands by immunohistochemistry indicating their importance in regulating the function of these glands139. Several other neuropeptides have been identified in I. scapularis, e.g., allatostatin-C, proctolin, pyrokinin-2, pyrokinin-3, pyrokinin-4, and periviscerokinin140,141. In addition, periviscerokinin was identified in I. ricinus and R. microplus by MALDI- TOF/TOF mass spectrometry142. Ixodes scapularis G-protein Coupled Receptor (GPCR) Genes Putative I. scapularis GPCRs were identified by TBLASTN searches of the tick genome assembly at VectorBase (https://www.vectorbase.org/). The primary source of query sequences included GPCRs from the mosquitoes An. gambiae143 and Ae. aegypti144 and the fruitfly D. melanogaster (FlyBase; http://flybase.org/), while additional invertebrate and vertebrate GPCR sequences were used when appropriate. Identified GPCRs were used to iteratively search the I. scapularis genome for additional GPCR sequences. Alignments of conceptual GPCR amino acid sequences were conducted with ClustalW or MultAlin software (http://bioinfo.genotoul.fr/multalin/multalin.html). GPCRs were categorized according to class and family based on sequence similarity to invertebrate and mammalian GPCRs and named according to nomenclature guidelines developed for invertebrate vectors as detailed at VectorBase (Supplementary Table 26). GPCR annotations described in this publication will be made available as third party annotations through VectorBase. Full length cDNAs of the following putative receptors were cloned and NCBI accession numbers were obtained as follows: Family A: 1. Kinin receptor (HM807526), 2. Periviscerokinin/CAPA receptor (JQ771528), 3. Orphan neuropeptide receptor (HM771426); Family B: Corticotropin-releasing hormone-like (CRF-like) receptor 2a (JF837597). Ixodes scapularis Chemosensory Ligand-Binding Protein Gene Families The search for putative homologs of the odorant-binding protein (OBP), chemosensory protein (CSP) and chemosensory protein family B (CheBs) genes was conducting as previously described145, and included several rounds of exhaustive searches using information from known protein sequences as queries146,147,148,149,150,151,152. First, we searched the preliminary predicted gene set using BLASTP (BLOSUM45 matrix with an e value threshold of 10−5), HMMER (http://hmmer.wustl.edu/) (e value domain threshold of 10−5), and HHsearch153 (e-value threshold of 10−5). The HMMER and HHsearch searches used Pfam154, PBP/GOBP (for OBP; PF01395), and OS-D (for CSP; PF03392), lipocalin (for vertebrate OBP; PF00061) HMM profiles. Furthermore, because some chemosensory family members are highly divergent, we also built extra custom HMM profiles (used in all HMMER and HHsearch searches). In the case of CheBs we used the members of the family recently identified and characterized by the J. Rozas group in the 12 Drosophila genomes. We built these profiles after clustering known protein sequences representative of all relevant phylogentic groups with BlastClust (ftp://ftp.ncbi.nih.gov/genomes) (e value threshold of 10−5, length coverage “-L” of 0.5 and score density “-S” of 0.6). We selected the four clusters with the highest numbers of sequences, aligned the clusters separately with MAFFT155 (E-INS-i with BLOSUM30 matrix, 10,000 maxiterate, and offset “0”) and, for each cluster, built an HMM profile using HMMER. Second, we searched the raw DNA sequence data using TBlastN (BLOSUM45 with e value threshold of 10−3), EXONERATE22 (50% of the maximum store threshold), and HMMER (e value domain threshold of 10−10). For the latter analysis, we searched against all 6-frames using Pfam’s and our custom HMM profiles as queries. All searches were performed exhaustively until no new hit was found, adding always all newly identified members to the queries. Finally, all results were manually curated, and the putative gene structure was checked for known OBP/CSP/CheB characteristics (signal peptide, typical secondary structures, presence of start and stop codons, etc). Ixodes scapularis Gustatory Receptor (GR) Genes The GR family was manual annotated using methods employed for insect and Daphnia genomes156. Briefly, TBLASTN searches were performed using major lineages of insect and Daphnia GRs as queries, and gene models were manually assembled in TEXTWRANGLER. Iterative searches were also conducted with each new tick protein as query until no new genes were identified in each major subfamily or lineage. Many of the genes identified are missing one or more short C-terminal exons, and while some of these were identified from raw reads, leading to fixed gene models, many were not. A final check for possible divergent genes/proteins was performed by HMMER at VectorBase using the automated annotations, and revealed nine existing models and just two additional highly divergent genes/proteins, Gr47 and 62. All of the IsGr genes and encoded proteins are detailed in Supplementary Table 29. All IsGr proteins are provided below in FASTA format. The IsGr gene set consists of 62 models, comparable in size with that of many insects and Daphnia. There were only five obvious pseudogenes, although some of the currently incomplete gene models might in fact be pseudogenes, and there are many gene fragments remaining in the genome. Gene models were present in the automated annotations for just 11 of these genes, and only one was precisely correct. For the genes that are intact within existing supercontigs, 23 new models have been added to the annotation, indicated with numbers starting with 800 in Supplementary Table 29. Although there are no ESTs for these Grs in the limited available transcriptome data, the basic gene structure for the entire IsGr set is a long first exon, followed by three short C-terminal exons separated by three phase 0 introns. The locations of these introns and their phases are the same as predicted by157 to be ancestral to the entire insect chemoreceptor superfamily, and are also shared with Gr genes in other animals (Robertson, unpublished). The only major exception is the Gr47-60 lineage, which are intronless in the coding region, presumably resulting from an ancient gene conversion with a reverse-transcribed mRNA. Phylogenetic Analysis of the Ixodes scapularis GRs. GR protein sequences of D. melanogaster, An. gambiae, D. pulex and I. scapularis were aligned with MAFFT using standard parameters (gap opening penalty = 1.530 and offset = 0.123) and 1000 iterations. Phylogenetic analysis was performed with the RAXML 7.0.4158 software using the PROTGAMMAWAG model. Tree figure (Supplementary Fig. 20) was edited with FigTree 1.3.1 (http://tree.bio.ed.ac.uk/software/figtree). Ixodes scapularis Cys-loop and iGluR Ligand-gated Ion Channel Genes iGluR and IR genes were identified and annotated using previously described methods159 (Supplementary Fig. 21; Supplementary Tables 30-31). MicroRNAs (miRNAs) in Ixodes scapularis Three different sets of microRNA (miRNA) gene predictions were consolidated from miRBase160, miROrtho161, and VectorBase162 resulting in the identification of a conservative set of 45 predicted miRNA genes (Supplementary Table 6). These include likely orthologs of recognized miRNAs such as bantam and iab-4. Although this set of miRNAs is unlikely to be complete, it is comparable in number to predictions from other arthropod genomes: e.g., 52 in the genome of the spider mite, T. urticae163, 50 in the water flea, D. pulex34, and 57 in the body louse, P. humanus164. Ixodes scapularis Proteomics Ixodes scapularis ISE6 cells (provided by Timothy J. Kurtti, University of Minnesota) were grown at 34°C in the absence of CO2 with L15B-300 complete media165. Cells were harvested followed by lipid removal (CHCl3: MeOH), acetone protein precipitation and denaturation. The protein samples were digested with trypsin and the resulting peptides were analyzed by high-pressure liquid chromatography (HPLC) and ESI-MS/MS with a hybrid ion trap mass spectrometer LTQ-Orbitrap LX (Thermo Scientific) at the Purdue Proteomics Facility, Bindley Bioscience Center. Mass spectrometry (MS) data were processed using with the Omics Discovery Pipeline166,167 and MS/MS peptide identification was performed using the Agilent Technologies Spectrum Mill MS Proteomics Workbench. The I. scapularis Wikel strain IscaW1.2 predicted protein set (https://www.vectorbase.org/) was used to perform the MS/MS protein database search and reverse scores were calculated to account for decoy database searching. Significant LC-MS peaks (p ≤ 0.05) discovered by the Omics Discovery Pipeline were matched to corresponding m/z values and retention times of a MS/MS peptide library (identified from Spectrum Mill). These identified peptides were subject to filtering by removing non-confident peptides and false positives168,169. This stringent analysis produced a final data set comprising approximately 486 proteins. This data set was queried to provide support for I. scapularis heme biosynthesis gene model predictions (Section S8). Ixodes Proteins Associated With Anaplasma Infection Cell Culture and Protein Extraction. The tick cell line ISE6, derived from I. scapularis embryos (provided by U.G. Munderloh, University of Minnesota, USA), was cultured in L15B medium as described previously170, but the osmotic pressure was lowered by the addition of one fourth sterile water by volume. The ISE6 cells were inoculated with A. phagocytophilum (NY18 isolate)-infected HL-60 cells as described previously170,171. Uninfected and infected cultures (N=5 independent cultures each) were sampled at 3 days post-infection (dpi) (early infection; percent infected cells 11- 17% (Avg±SD, 13±2)) and 10 dpi (late infection; percent infected cells 56-61% (Avg±SD, 58±2)), the cells were centrifuged at 10,000 g for 3 min, and cell pellets were frozen in liquid nitrogen until used for protein extraction. Approximately 107 cells were pooled from each condition and lysed in 350 µl lysis buffer (PBS, 1% Triton X-100, 1 mM sodium vanadate, 1 mM sodium fluoride, 1 mM PMSF, 1µg/ml leupeptin, 1µg/ml pepstatin) for 30 min at 4ºC. Total cell extracts were centrifuged at 200 g for 5 min to remove cell debris. The supernatants were collected and protein concentration was determined using the Bradford Protein Assay (Bio-Rad, Hercules, CA, USA) with BSA as standard. Proteomics analysis of infected and uninfected Ixodes scapularis ISE6 tick cells. Proteomics analysis of I. scapularis ISE6 tick cells in response to A. phagocytophilum infection was performed using protein one-step in-gel digestion, peptide iTRAQ labeling, IEF fractionation, LC-MS/MS analysis and peptide identification. Protein extracts from the four experimental conditions, control uninfected early (CE), infected early (IE), control uninfected late (CL) and infected late (IL) (100 μg each) were resuspended in up to 300 µl of sample buffer and applied using a 5-well comb on a conventional SDS-PAGE gel (1.5 mm-thick, 4% stacking, 10% resolving). The run was stopped as soon as the front entered 3 mm into the resolving gel so that the whole proteome became concentrated in the stacking/resolving gel interface. The unseparated protein bands were visualized by Coomassie Brilliant Blue R-250 staining, excised, cut into cubes (2 mm2) and digested overnight at 37ºC with 60 ng/µl trypsin (Promega, Madison, WI, USA) at 5:1 protein:trypsin (w/w) ratio in 50 mM ammonium bicarbonate, pH 8.8 containing 10% (v/v) acetonitrile (ACN) and 0.01% (w/v) 5- cyclohexyl-1-pentyl-ß-D-maltoside (CYMAL-5)172. The resulting tryptic peptides from each proteome were extracted by 1 hr incubation in 12 mM ammonium bicarbonate, pH 8.8. trifluoroacetic acid (TFA) was added to a final concentration of 1% and the peptides were finally desalted onto C18 OASIS HLB Extraction cartridges (Waters, Milford, Massachusetts, USA) to remove the amine-containing buffers and dried-down. Dried peptides were taken up in 30 µl of iTRAQ dissolution buffer provided with the kit (Applied Biosystems, Madrid, Spain) and labeled by adding 70 µl of the corresponding iTRAQ reagent in ethanol and incubating for 1 hr at room temperature in 70% ethanol, 180 mM triethylammoniumbicarbonate (TEAB), pH 8.53. CE was labeled with 114, IE was labeled with 115, CL was labeled with 116 and IL labeled with 117 iTRAQ tags. After quenching the reaction with 100 µl 0.1% formic acid for 30 min, samples were brought to dryness to completely stop the labeling reaction. This quenching process was repeated once more to promote TEAB volatilization. The four labeled samples were resuspended in 100 µl 0.1% formic acid and combined into one tube. The mixture was dried down, redissolved in 3.3 ml 5 mM ammonium formiate, pH 3, cleaned up with SCX Oasis cartridges (Waters) using as elution solution 1 M ammonium formiate pH 3, containing 25% ACN, and dried down. The peptide pools were resuspended in 0.5 ml 0.1% TFA, desalted onto C18 Oasis cartridges using as elution solution 50% ACN in 5 mM ammonium formiate, pH 3 and dried down. The sample was taken up in focusing buffer (5% glycerol and 2% IPG buffer pH 3-10 (GE Healthcare, Madrid, Spain) loaded onto 24-wells over a 24 cm-long Immobiline DryStrip, pH3-10 (GE Healthcare) and separated by IEF on a 3100 OFFgel fractionator (Agilent, Santa Clara, CA, USA), using the standard method for peptides recommended by the manufacturer. The recovered fractions were acidified with 20 μl of 1 M ammonium formiate, pH 3, and the peptides were desalted using OMIX C18 tips (Varian, Palo Alto, CA, USA). After elution with 50% ACN in 5 mM ammonium formiate, pH 3, the peptides were dried-down prior to RP-HPLC-LIT analysis. All samples were analyzed by LC- MS/MS using a Surveyor LC system coupled to a linear ion trap mass spectrometer model LTQ (Thermo-Finnigan, San Jose, CA, USA) as described previously173. The LTQ was programmed to perform a data-dependent MS/MS scan on the 15 most intense precursors detected in a full scan from 400 to 1600 amu (3 µscans, 200 ms injection time, 10,000 ions target). Singly charged ions were excluded from the MS/MS analysis. Dynamic exclusion was enabled using the following parameters: 2 repeat counts, 90 s repeat duration, 500 exclusion size list, 120 s exclusion duration and 2.1 amu exclusion mass width. PQD parameters were set at 100 ms injection time, 8 microscans per scan, 2 amu isolation width, 28% normalized collision energy, 0.6 activation Q, 0.3 ms activation time. For PQD spectra generation 10,000 ions were accumulated as target and automatic gain control was used to prevent over-filling of the ion trap. Protein identification was carried out as described previously173 using SEQUEST algorithm (Bioworks 3.2 package, Thermo Finnigan), allowing optional (Methionine oxidation) and fixed modifications (Cysteine carboxamidomethylation, Lysine and N-terminal modification of +144.1020 Da). The MS/MS raw files were searched against the alphaproteobacteria combined with the arachnida Swissprot database (Uniprot release 15.5, 7 July, 2009) supplemented with porcine trypsin and human keratins. This joint database contains 638,408 protein sequences. To calculate false discovery rate, the same collections of MS/MS spectra were also searched against inverted databases constructed from the same target databases. The alphaproteobacteria Swissprot database was used to identify and discard Anaplasma and possible symbiotic bacterial sequences from further analyses. A total of 1447 MS/MS spectra were assigned to 903 unique peptides174 (false discovery rate, FDR=10%). After identifying and discarding Anaplasma and other bacterial symbiotic peptide sequences, the 735 remaining peptides belonged to 424 different proteins (Supplementary Tables 32-35). Of these, 88% had similarity to Ixodes sequences while 95% had similarity to sequences from other tick species (Supplementary Table 35). Proteomics data showed a strong correlation with conceptual coding sequences predicted from the I. scapularis genome. For some of the identified proteins, the discrepancy between peptide data and predicted protein sequence may reflect polymorphisms between ISE6 cells and the Wikel tick strain and the need to improve I. scapularis gene models. Population Structure of Ixodes scapularis Across North America Sample collection Ixodes scapularis adult females were collected from eight geographical locations in the USA: Florida, Indiana, Maine, Massachusetts, New Hampshire, North Carolina, Virginia, and Wisconsin by our research group or kindly provided by collaborators. In addition, samples were obtained for the reference Wikel strain from the University of Texas Medical Branch, Galveston, TX. The colony has been maintained in continuous culture since establishment. The GPS location was recorded for each field collected sample. Samples were stored in 80% ethanol at 4°C, in ALT buffer (SIGMA) or at -70°C until processing. Genomic DNA was separately extracted from individual females using a phenol:chloroform:isopropyl alcohol (SIGMA) method and treated with RNAse A (Ambion). RAD library preparation RAD-seq libraries were produced from 77 individual female I. scapularis. One µg genomic DNA from each individual was digested in a 50 μL reaction with 100 units of SbfI-HF restriction enzyme (New England Biolabs, Beverly MA, USA) for 1.5 hrs at 37°C, followed by incubation at 65°C for 20 minutes to inactivate the enzyme. An aliquot (1 µl) was analyzed on 1% agarose gel to check the digestion efficiency and the remaining product was ligated to the unique P1 RAD adapter primers (50 nM per reaction) with 1000 units of T4 ligase in 1× NEB buffer 2 (New England Biolabs) and 100 mM rATP (Fermentas). Samples were incubated for one hr at 20°C, followed by enzyme inactivation at 65°C for 20 minutes. Adapter ligated DNA fragments from individual samples were pooled and sonicated using Qsonica sonicator for six minutes at maximum power. Samples were cleaned with MinElute PCR purification kit (Qiagen). Fragments of 400-600 bp were selected using 1% agarose gel and DNA was recovered with the MinElute gel extraction kit (Qiagen). Blunt ends were repaired using blunting enzyme mix (New England Biolabs) in 1X blunting buffer and 1mM dNTP mix. Samples were incubated for one hr at 20°C and purified with MinElute PCR purification kit (Qiagen). A-overhangs (10mM dATP; Fermentas) were then added using Klenow fragment (3’-5’ exo) (New England Biolabs) in 1x NEB Buffer 2. Samples were incubated for one hr at 20°C and purified with MinElute PCR purification kit (Qiagen). The P2 RAD adapter (10 µM) was ligated using 1000 units of T4 DNA ligase (New England Biolabs) in 1× NEB buffer 2 (New England Biolabs) and 100mM rATP (Fermentas). Samples were incubated for one hr at 20°C followed by purification with MinElute PCR purification kit (Qiagen). Finally, 10 μL of the P1 and P2 adapter ligated DNA was used as a template in a 100 μL PCR reaction with 50 μL of the Phusion High Fidelity 2× Master mix (New England Biolabs) and 2 μL each of 10 μM P1 and P2 primers. PCR conditions were: 98°C for 30 s, 14 cycles of 98°C for 10 s, 65°C for 30 s, 72°C for 30 s, and a final elongation step at 72°C for 5 min. Samples were sequenced on the Illumina HiSeq2500 platform in the Rapid run mode to obtain 150 bp single-end reads. Sequence processing and SNP calling Illumina reads were processed by the Bioinformatics Core at Purdue University. Reads were corrected for barcodes and restriction site, low quality bases (Phred score less than 10) were trimmed and all reads were trimmed to 140 bp and then de- multiplexed (sorted by barcode) using the “process_radtags.pl” script of STACKS175,176. Quality trimmed reads were separately aligned to the I. scapularis Wikel genome assembly, IscaW1 (Ixodes-scapularis-Wikel_SCAFFOLDS_IscaW1.fa downloaded from VectorBase) using the end-to-end mode and default parameters of Bowtie2 v 2.2.3177. Three individual samples with the percent of mapped reads less than 50% were removed from analysis. Polymorphic loci (catalogue loci) were identified for SNP discovery using the ref_map.pl pipeline in STACKS version (v1.19). First, sequences aligned to the same genomic location were stacked together and merged to form loci. Only loci with a sequencing depth of ten or more reads per individual were retained. SNPs at each locus were called by STACKS implementing a multinomial-based likelihood model regardless of the reference sequence itself. Lastly, a catalogue of all possible loci and alleles was generated and each individual was matched against the catalogue. In total, 745,760 SNPs across 35,460 loci were identified using the ‘population’ program within the STACKS package based on the criteria: (1) minimum 60% individuals within a population, (2) minimum two populations to report a locus, and (3) minimum stack depth of 10 per locus. F-statistics and Population structure The population program within STACKS (v1.19) was used176 in combination with the system of Wright178 to assess fixation index and genetic variation within and among populations. The F statistic was used to measure fixation index (FIS) and genetic variability (FST). Using 745,760 SNPs, genome-wide measures of diversity, such as observed heterozygosity (HO), expected heterozygosity (HE), nucleotide diversity (π) across individuals (intra-population) and genetic differentiation were calculated to assess genetic distance or differentiation as evidence of selection. We enabled kernel smooth function in population with a default window size of 150kb such that a kernel smooth function (weights function) was applied to all SNP locations within a sliding window covering a 3x150 Kb region at either side of a center polymorphic locus. This function uses the distance between each SNP within the sliding window and the center SNP, and the defined window size, so that FIS have stable values within each sliding window and across the whole genome. The same process was conducted for π. At each SNP locus, π was calculated from the count of a specific allele in the population, and the sample size of all alleles in the population179,180. At each SNP location, FIS =1- Ho/π. The reported FIS (Supplementary Table 36) is the population-level mean value across all the polymorphic sites within each sub-population. FST is an indication of variation among populations. At each SNP position, FST was calculated by the following formula176,180,181: where, nj is the sample size of alleles in population j, and πj is π in population j, while πall is π calculated over the pair of populations (pairwise comparison between two sub- populations) (Supplementary Table 37). In addition, we used fastStructure (beta release)182 to assess population structure using a genome wide set of 745,760 SNPs across 35,460 catalogue loci (~21 SNPs per loci) and a subset of 34,693 SNPs, the first SNP per catalogue locus to resolve genetic structure at a broad spatial scale. fastStructure delineates clusters of individuals on the basis of genotypes at multiple loci using a Bayesian approach. Models were fitted with a defining number of clusters (K) from 1 to 20. Next, the most suitable K (K=6) was selected for the full set of 745,760 SNPs using a python script chooseK.py from fastStructure. Briefly, marginal likelihood values for K=1 to 20 were manually vetted. Marginal likelihood increased from -0.4730 to -0.3882 when K increased from 1 to 6, and then decreased by 0.01 at K=7 (range -0.3953 to -0.3825). The same method was used to select the most suitable K (K=5) for the subset of 34,693 SNPs. Marginal likelihood increased from -0.4975 to -0.4004 when K increased from 1 to 5, then decreased to -0.4045 at K=6 reaching a plateau afterwards. Using the output from fastStructure and DISTRUCT (v1.1)183, a bar plot was created where each individual of the sample is represented by a vertical line divided into K colored segments with the length of each segment being proportional to the estimated membership in each of the inferred K groups. Expression of Ixodes scapularis ligand-gated ion channels in Xenopus laevis oocytes Functional expression of an Ixodes scapularis ligand-gated ion channel subunit (known as IscaGluCl1) in Xenopus laevis oocytes (Fig. 7; Supplementary Fig. 25) was achieved by cRNA injection and two-electrode voltage clamp electrophysiology. A brief description of the methods is provided in the main paper and a more comprehensive account of the technique is available184. Supplementary References 1. Geraci, N. S., Johnston, J. S., Robinson, J. P., Wikel, S. K. & Hill, C. A. Variation in genome size of argasid and ixodid ticks. Insect Biochem. Mol. Biol. 37, 399-408 (2007). 2. Hill, C. A. et al. The position of repetitive DNA sequence in the southern cattle tick genome permits chromosome identification. Chromosome Res. 17, 77-89 (2009). 3. Myers, E. W. et al. A whole-genome assembly of Drosophila. Science 287, 2196- 2204 (2000). 4. Rusch, D. B. et al. The Sorcerer II Global Ocean Sampling Expedition: Northwest Atlantic through Eastern Tropical Pacific. PLoS Biol 5, e77 (2007). doi:10.1371/journal.pbio.0050077. 5. Levy, S. et al. The diploid genome sequence of an individual human. PLoS Biol. 5, e254 (2007). doi:10.1371/journal.pbio.0050254. 6. Denisov, G. et al. Consensus Generation and Variant Detection by Celera Assembler. Bioinformatics 24, 1035-1040 (2008). 7. Miller, J. R. et al. Aggressive Assembly of Pyrosequencing Reads with Mates. Bioinformatics 24, 2818-2824 (2008). 8. Gillespie, J. J. et al. PATRIC: The Comprehensive Bacterial Bioinformatics Resource with a Focus on Human Pathogenic Species. Infect. Immun. 79, 4286-4298 (2011). 9. Kurtti, T. J. et al. Rickettsia buchneri sp. nov., a rickettsial endosymbiont of the blacklegged tick Ixodes scapularis. Internat. J. System. Evol. Microbiol. 65, 965–970 (2015). 10. Gillespie, J. J. et al. A Rickettsia genome overrun by mobile genetic elements provides insight into the acquisition of genes characteristic of an obligate intracellular lifestyle. J. Bacteriol. 194, 376-394 (2012). 11. Price, A. L., Jones, N. C. & Pevzner, P. A. De novo identification of repeat families in large genomes. Bioinformatics 21, i351-8 (2005). doi:10.1093/bioinformatics/bti1018. 12. Bao, Z. & Eddy, S. R., Automated de novo identification of repeat sequence families in sequenced genomes. Genome Res. 12, 1269-1276 (2002). 13. Smit, A. F. A., Hubley, R. & Green, P. RepeatMasker Open-3.0. 1996-2010. . 14. Huang, X., Adams, M. D., Zhou, H. & Kerlavage, A. R. A tool for analyzing and annotating genomic sequences. Genomics 46, 37-45 (1997). 15. Birney, E., Clamp, M. & Durbin, R., GeneWise and Genomewise. Genome Res. 14, 988-995 (2004). 16. Haas, B. J. et al. Improving the Arabidopsis genome annotation using maximal transcript alignment assemblies. Nucl. Acids Res. 31, 5654-5666 (2003). 17. Stanke, M. & Morgenstern, B. AUGUSTUS: a web server for gene prediction in eukaryotes that allows user-defined constraints. Nucl. Acids Res. 33: W465-W467 (2005). doi:10.1093/nar/gki458. 18. Majoros, W., Pertea, M., Delcher, A. L. & Salzberg, S. L. Efficient decoding algorithms for generalized hidden Markov model gene finders. BMC Bioinformatics 6, 16 (2005). doi:10.1186/1471-2105-6-16. 19. Haas, B. J. et al. Automated eukaryotic gene structure annotation using EVidenceModelerand the Program to assemble spliced alignments. Genome Biol. 9, R7 (2008). doi:10.1186/gb-2008-9-1-r7. 20. Flicek, P. et al. Ensembl's 10th year. Nucl. Acids Res. 38, D557-D562 (2010). doi:10.1093/nar/gkp972. 21. The UniProt Consortium. Ongoing and future developments at the Universal Protein Resource. Nucl. Acids Res. 39, D214-D219 (2011). doi:10.1093/nar/gkq1020. 22. Slater, G. S. & Birney, E. Automated generation of heuristics for biological sequence comparison. BMC Bioinformatics 6, 31 (2005). 23. Korf, I. Gene finding in novel Genomes. BMC Bioinformatics 5, 59 (2004). doi:10.1186/1471-2105-5-59. 24. Conesa, A. et al. Blast2GO: a universal tool for annotation, visualization and analysis in functional genomics research. Bioinformatics 21, 3674-3676 (2005). 25. Waterhouse, R. M., Zdobnov, E. M., Tegenfeldt, F., Li, J. & Kriventseva, E. V. OrthoDB: the hierarchical catalog of eukaryotic orthologs in 2011. Nucleic Acids Res. 39, D283-D288 (2011). 26. Edgar, R. MUSCLE: multiple sequence alignment with high accuracy and high throughput. Nucl. Acids Res. 32, 1792-1797 (2004). 27. Castresana, J. Selection of conserved blocks from multiple alignments for their use in phylogenetic analysis. Mol. Biol. Evol. 17, 540-552 (2000). 28. Guindon, S. et al. New algorithms and methods to estimate maximum-likelihood phylogenies: assessing the performance of PhyML 3.0. Syst. Biol. 59, 307-321 (2010). 29. Rogozin, I. B., Wolf, Y. I., Sorokin, A. V., Mirkin, B. G. & Koonin, E. V., Remarkable interkingdom conservation of intron positions and massive, lineage-specific intron loss and gain in eukaryotic evolution. Curr. Biol. 13, 1512-1517 (2003). 30. Rogozin, I. B., Lyons-Weiler, J. & Koonin, E. V. Intron sliding in conserved gene families. Trends Genet. 16, 430-432 (2000). 31. Felsenstein, J. Coalescents in full bloom. Evolution 63, 3275–3276 (2009).doi:10.1111/j.1558-5646.2009.00811.x. 32. Junier, T. & Zdobnov, E. M. The Newick utilities: high-throughput phylogenetic tree processing in the Unix shell. Bioinformatics 26, 1669-1670 (2010). 33. Csurös, M. et al. Malin: maximum likelihood analysis of intron evolution in eukaryotes. Bioinformatics 24, 1538-1539 (2008). 34. Colbourne, J. K. et al. The ecoresponsive genome of Daphnia pulex. Science 331, 555-561 (2011). 35. Li, L., Stoeckert, C. J. Jr. & Roos, D. S. OrthoMCL: identification of ortholog groups for eukaryotic genomes. Genome Res. 13, 2178-2189 (2003). 36. Chen, F., Mackey, A. J., Vermunt, J. K. & Roos, D. S. Assessing performance of orthology detection strategies applied to eukaryotic genomes. PLoS ONE 2(4): e383, (2007). doi:10.1371/journal.pone.0000383. 37. Schlueter, J. et al. Mining EST databases to resolve evolutionary events in major crop species. Genome. 47, 868-876 (2004). 38. Rice, P., Longden, I. & Bleasby, A. EMBOSS: the European molecular biology open software suite. Trends Genet. 16, 276–277 (2000). 39. Lynch, M. & Conery, J. The evolutionary fate and consequences of duplicate genes. Science 290, 1151-1155 (2000). 40. Benson, G. Tandem repeats finder: a program to analyze DNA sequences. Nucl. Acids Res. 27, 573–580 (1999). 41. Meyer, J. M., Kurtti, T. J., Van Zee, J. P. & Hill, C. A. Genome organization of major tandem repeats in the hard tick, Ixodes scapularis. Chrom. Res. 18, 357-370 (2010). 42. Tu, Z. Eight novel families of miniature inverted repeat transposable elements in the African malaria mosquito, Anopheles gambiae. Proc. Natl. Acad. Sci U.S.A. 98, 1699-1704 (2001). 43. McCarthy, E. M. & McDonald, J. F. LTR_STRUC: a novel search and identification program for LTR retrotransposons. Bioinformatics 19, 362-367 (2003). 44. Tubio, J. M., Naveira, H. & Costas, J. Structural and evolutionary analyses of the Ty3/gypsy group of LTR retrotransposons in the genome of Anopheles gambiae. Mol. Biol. Evol. 22, 29-39 (2005). 45. Tubio, J. M. et al. Evolutionary dynamics of the Ty3/gypsy LTR retrotransposons in the genome of Anopheles gambiae. PloS ONE 6, e16328, (2011). doi:10.1371/journal.pone.0016328. 46. Jurka, J. et al. Repbase update, a database of eukaryotic repetitive elements. Cytogenet Genome Res. 110, 462-467 (2005). 47. Altschul, S. F. et al. Gapped BLAST and PSI-BLAST: a new generation of protein database search programs. Nucl. Acids Res. 25, 3389-3402 (1997). 48. Tatusova, T. A. & Madden, T. L. Blast 2 sequences-a new tool for comparing protein and nucleotide sequences. FEMS Microbiol. Lett. 174, 247-250 (1999). 49. Kennedy, R. C., Unger, M. F., Christley, S., Collins, F. H. & Madey, G. R. An automated homology-based approach for identifying transposable elements. BMC Bioinformatics 12, 130, (2011). doi:10.1186/1471-2105-12-130. 50. Xiong, Y. & Eickbush, T. H. Origin and evolution of retroelements based upon their reverse transcriptase sequences. EMBO J. 9, 3353-3362 (1990). 51. Malik, H. S., Burke, W. D. & Eickbush, T. H. The age and evolution of non-LTR retrotransposable elements. Mol. Biol. Evol. 16, 793–805 (1999). 52. Guindon, S. & Gascuel, O. A Simple, Fast, and Accurate Algorithm to Estimate Large Phylogenies by Maximum Likelihood. Syst. Biol. 5, 696-704 (2003). 53. Lander, E. S. et al. Initial sequencing and analysis of the human genome. Nature 409, 860-921 (2001). 54. Holt, R. A. et al. The genome sequence of the malaria mosquito Anopheles gambiae. Science 298, 129-149 (2002). 55. Lovsin, N., Gubensek, F. & Kordi, D. Evolutionary dynamics in a novel L2 clade of non-LTR retrotransposons in Deuterostomia. Mol. Biol. Evol. 18, 2213–2224 (2001). 56. Biedler, J. & Tu, Z. Non-LTR retrotransposons in the African malaria mosquito, Anopheles gambiae: unprecedented diversity and evidence of recent activity. Mol. Biol. Evol. 20, 1811–1825 (2003). 57. Arensburger, P. et al. Sequencing of Culex quinquefasciatus establishes a platform for mosquito comparative genomics. Science 330, 86-88 (2010). 58. Jakubczak, J. L., Burke, W. D. & Eickbush, T. H. Retrotransposable elements R1 and R2 interrupt the rRNA genes of most insects. Proc. Natl. Acad. Sci. U.S.A. 88, 3295–3299 (1991). 59. Felger, I. & Hunt, J. A. A non-LTR retrotransposon from the Hawaiian Drosophila: the LOA element. Genetica 85, 119–130 (1992). 60. Munderloh, U. G., Liu, Y., Wang, M., Chen, C. & Kurtti, T. J. Establishment, maintenance and description of cell lines from the tick Ixodes scapularis. J. Parasitol. 80, 533–543 (1994). 61. Chen, C., Munderloh, U. G. & Kurtti, T. J. Cytogenetic characteristics of cell lines from Ixodes scapularis (Acari: Ixodidae). J. Med. Entomol. 31, 425-434 (1994). 62. Zwick, M. S. et al. A rapid procedure for the isolation of C0t-1 DNA from plants. Genome 40, 138-142 (1997). 63. Vítková, M., Král, J., Traut, W., Zrzavy, J. & Marec, F. The evolutionary origin of insect telomeric repeats, (TTAGG)n. Chromosome Res. 13, 145-156 (2005). 64. Francischetti, I. M. B., Sá-Nunes, A., Mans, B. J., Santos, I. M. & Ribeiro, J. M. C. The role of saliva in tick feeding. Front. Biosci. 14, 2051-2088 (2009). 65. Ribeiro, J. M. & Arca, B. From sialomes to the sialoverse: An insight into the salivary potion of blood feeding insects. Adv. Insect Physiol. 37, 59-118 (2009). 66. Arca, B. et al. An updated catalogue of salivary gland transcripts in the adult female mosquito, Anopheles gambiae. J. Exp. Biol. 208, 3971-3986 (2005). 67. Panzera, F. et al. Genome size determination in chagas disease transmitting bugs (hemiptera-triatominae) by flow cytometry. Am. J. Trop. Med. Hyg. 76, 516-521 (2007). 68. Kondrashov, F. A., Rogozin, I. B., Wolf, Y. I. & Koonin, E. V. Selection in the evolution of gene duplications. Genome Biol. 3, research0008, doi:10.1186/gb-2002-3- 2-research0008 (2002). 69. Sankoff, D. Gene and genome duplication. Curr. Opin. Genet. Dev. 11, 681-684 (2001). 70. Ascenzi, P. et al. The bovine basic pancreatic trypsin inhibitor (Kunitz inhibitor): a milestone protein. Curr. Protein Pept. Sci. 4, 231-251 (2003). 71. Castaneda, O. & Harvey, A. L. Discovery and characterization of cnidarian peptide toxins that affect neuronal potassium ion channels. Toxicon. 54, 1119-11124 (2009). 72. Harvey, A. L. Recent studies on dendrotoxins and potassium ion channels. Gen. Pharmacol. 28, 7-12 (1997). 73. Paesen, G. C. et al. An ion-channel modulator from the saliva of the brown ear tick has a highly modified Kunitz/BPTI structure. J. Mol. Biol. 389, 734-47 (2009). 74. Ribeiro, J. M. et al. An annotated catalog of salivary gland transcripts from Ixodes scapularis ticks. Insect Biochem. Mol. Biol. 36, 111-129 (2006). 75. Valenzuela, J. G. et al. Exploring the sialome of the tick, Ixodes scapularis. J. Exp. Biol. 205, 2843-2864 (2002). 76. Kotsyfakis, M., Karim, S., Andersen, J. F., Mather, T. N. & Ribeiro, J. M. Selective cysteine protease inhibition contributes to blood-feeding success of the tick Ixodes scapularis. J. Biol. Chem. 282, 29256-29263 (2007). 77. Schultz, J., Copley, R. R., Doerks, T., Ponting, C. P. & Bork, P. SMART: a web- based tool for the study of genetically mobile domains. Nucleic Acids Res. 28, 231-234 (2000). 78. Campbell, C. L. et al. Midgut and salivary gland transcriptomes of the arbovirus vector Culicoides sonorensis (Diptera: Ceratopogonidae). Insect Mol. Biol. 14, 121-36 (2005). 79. Wilson, A. D., Heesom, K. J., Mawby, W. J., Mellor, P. S. & Russell, C. L. Identification of abundant proteins and potential allergens in Culicoides nubeculosus salivary glands. Vet. Immunol. Immunopathol. 122, 94-103 (2008). 80. Andersen, J. F., Pham, V. M., Meng, Z., Champagne, D. E. & Ribeiro, J. M. Insight into the Sialome of the Black Fly, Simulium vittatum. J. Proteome Res. 8, 1474- 1488 (2009). 81. Francischetti, I. M., Mather, T. N. & Ribeiro, J. M. Penthalaris, a novel recombinant five-Kunitz tissue factor pathway inhibitor (TFPI) from the salivary gland of the tick vector of Lyme disease, Ixodes scapularis. Thromb. Haemost. 91, 886-898 (2004). 82. Francischetti, I. M., Valenzuela, J. G., Andersen, J. F., Mather, T. N. & Ribeiro, J. M. Ixolaris, a novel recombinant tissue factor pathway inhibitor (TFPI) from the salivary gland of the tick, Ixodes scapularis: identification of factor X and factor Xa as scaffolds for the inhibition of factor VIIa/tissue factor complex. Blood 99, 3602-3612 (2002). 83. Benson, D. A., Karsch-Mizrachi, I., Lipman, D. J., Ostell, J. & Sayers, E. W. GenBank. Nucl. Acids Res. 40, D32-D53 (2011). doi:10.1093/nar/gkr1202. 84. Lawson, D. et al. VectorBase: a home for invertebrate vectors of human pathogens. Nucleic Acids Res., 35, D503–D505 (2007). 85. Lawson, D. et al. VectorBase: a data resource for invertebrate vector genomics. Nucleic Acids Res. 37, D583–D587 (2009). 86. Kersey, P. J. et al. Ensembl Genomes: an integrative resource for genome-scale data from non-vertebrate species. Nucl. Acids Res. 40, D91-D97, (2011).doi:10.1093/nar/gkr895. 87. Bateman, A. et al. The Pfam protein families database. Nucl. Acids Res. 32, D138-D141 (2004). doi:10.1093/nar/gkh121. 88. Hulo, N. et al. The PROSITE database. Nucl. Acids Res. 34, D227-D230 (2006). doi:10.1093/nar/gkj063. 89. Marchler-Bauer, A. et al. CDD: a Conserved Domain Database for the functional annotation of proteins. Nuc. Acids Res. 39, D225-D229 (2011). doi:10.1093/nar/gkq1189. 90. Valanne, S., Wang, J. H. & Ramet, M. The Drosophila Toll signaling pathway. J. Immunol. 186, 649-656 (2011). 91. Shin, S. W. et al. REL1, a homologue of Drosophila dorsal, regulates toll antifungal immune pathway in the female mosquito Aedes aegypti. J. Biol. Chem. 280, 16499-16507 (2005). 92. Kim, J. H. et al. Comparison of the humoral and cellular immune responses between body and head lice following bacterial challenge. Insect Biochem. Mol. Biol. 41, 332-339 (2011). 93. Gerardo, N. M. et al. Immunity and other defenses in pea aphids, Acyrthosiphon pisum. Genome Biol. 11, R21 (2010). doi:10.1186/gb-2010-11-2-r21. 94. Goto, A. et al. Akirins are highly conserved nuclear proteins required for NF-B- dependent gene expression in Drosophila and mice. Nature Immunol. 9, 97-104 (2008). 95. de la Fuente, J. et al. The tick protective antigen, 4D8, is a conserved protein involved in modulation of tick blood ingestion and reproduction. Vaccine 24, 4082-4095 (2006). 96. de la Fuente, J. et al. Functional genomic studies of tick cells in response to infection with the cattle pathogen, Anaplasma marginale. Genomics 90, 712–722 (2007). 97. Kurscheid, S. et al. Evidence of a tick RNAi pathway by comparative genomics and reverse genetics screen of targets with known loss-of-function phenotypes in Drosophila. BMC Mol. Biol. 10, 26 (2009). doi:10.1186/1471-2199-10-26. 98. Khvorova, A., Reynolds, A., Jayasena, S. D. Functional siRNAs and miRNAs exhibit strand bias. Cell. 115, 209-216 (2003). 99. Schwarz, D. S., Hutvagner, G., Haley, B., Zamore, P. D. Evidence that siRNAs function as guides, not primers, in the Drosophila and human RNAi pathways. Mol. Cell. 10, 537-548 (2002). 100. Hammond, S. M., Bernstein, E., Beach, D. & Hannon, G. J. An RNA-directed nuclease mediates post-transcriptional gene silencing in Drosophila cells. Nature 404, 293-296 (2000). 101. Ding, S. W. RNA-based antiviral immunity. Nat. Rev. Immunol. 10, 632-644 (2010). 102. Waterhouse, R. M. et al. Evolutionary dynamics of immune-related genes and pathways in disease-vector mosquitoes. Science 316, 1738-1743 (2007). 103. Wang, Y. & Zhu, S. The defensin gene family expansion in the tick Ixodes scapularis. Dev. Comp. Immunol. 35, 1128-1134 (2011). 104. Neese, P. A., Sonenshine, D. E., Kallapur, V. L., Apperson, C. S. & Roe, R. M. Absence of insect juvenile hormones in the American dog tick, Dermacentor variabilis (Say) (Acari: Ixodidae) and Ornithodoros parkeri Cooley (Acari: Argasidae). J Insect Physiol. 46, 477-490 (2000). 105. Thompson, D. M. et al. In vivo role of 20-hydroxyecdysone in the regulation of the vitellogenin mRNA and egg development in the American dog tick, Dermacentor variabilis (Say). J. Insect Physiol. 51, 1105-1116 (2005). 106. Pound, J. M., Oliver, J. H. Jr. Juvenile hormone: evidence of its role in the reproduction of ticks. Science. 206, 355-357 (1979). 107. Donohue, K. V., Khalil, M. S., Mitchell, R. D., Sonenshine, D. E. & Roe, R. M. Molecular characterization of the major hemelipoglycoprotein in ixodid ticks. Insect Mol. Biol. 17, 197-208 (2008). 108. Rutherford, K. et al. Artemis: sequence visualization and annotation. Bioinformatics 16, 944-945 (2000). 109. Law, J. H., Ribeiro, J. M. C. & Wells, M. A. Biochemical insights derived from insect diversity. Ann. Rev. Biochem. 64, 87-111 (1992). 110. Mans, J. B. & Neitz, A. W. H. Adaptation of ticks to a blood-feeding environment: evolution from a functional prospective. Insect Biochem. Mol. Biol. 34, 1-17 (2004). 111. Braz, G. R. C., Coelho, H. S. L., Masuda, H. & Oliveira, P. L. A missing metabolic pathway in the cattle tick Boophilus microplus. Curr. Biol. 9, 703-706 (1999). 112. Hamza, I., Chauhan, S., Hassett, R. & O’Brian, M. R. The bacterial irr protein is required for coordination of heme biosynthesis with iron availability. J. Biol. Chem. 273, 21669-21674 (1998). 113. Furuyama, K., Kaneko, K. & Vargas, P. D. Heme as a magnificent molecule with multiple missions: heme determines its own fate and governs cellular homeostasis. Tohoku J. Exp. Med. 213, 1-16 (2007). 114. Machado, E. A., Oliveira, P. L., Moreira, M. F., de Souza, W. & Masuda, H. Uptake of Rhodnius heme-binding protein (RHBP) by the ovary of Rhodnius prolixus. Arch. Insect Biochem. Physiol. 39, 133-143 (1998). 115. Oliveira, P. L. et al. A heme-binding protein from hemolymph and oocytes of the blood-sucking insect, Rhodnius prolixus. Isolation and characterization. J. Biol. Chem. 270, 10897-10901 (1995). 116. Weichsel, A., Andersen, J. F., Champagne, D. E., Walker, F. A. & Montfort, W. R. Crystal structures of a nitric oxide transport protein from a blood-sucking insect. Nat. Struct. Biol. 5, 304-309 (1998). 117. Donohue, K. V., Khalil, S. M. S., Sonenshine, D. E. & Roe, R. M. Heme-binding storage proteins in the Chelicerata. J. Insect Physiol. 55, 287-296 (2009). 118. Horigane, M., Shinoda, T., Honda, H. & Taylor, D. Characterization of a vitellogenin gene reveals two phase regulation of vitellogenesis by engorgement and mating in the soft tick Ornithodoros moubata (Acari: Argasidae). Insect Mol. Biol. 19, 501-515 (2010). 119. Maya-Monteiro, C. M. et al. HeLp, a heme lipoprotein from the hemolymph of the cattle tick, Boophilus microplus. J. Biol. Chem. 275, 36584-36589 (2000). 120. Horn, M., et al. Hemoglobin digestion in blood-feeding ticks: mapping a multipeptidase pathway by functional proteomics. Chem Biol. 16,1053-1063 (2009). 121. Yamaji, K. et al. Hemoglobinase activity of a cysteine protease from the ixodid tick Haemaphysalis longicornis. Parasitol Int. 58, 232-237 (2009). 122. Estrela A. B., Seixas, A., Teixeira Vde, O., Pinto, A. F. & Termignoni, C. Vitellin- and hemoglobin-digesting enzymes in Rhipicephalus (Boophilus) microplus larvae and females. Comp. Biochem. Physiol. B Biochem. Mol. Biol. 157, 326-335 (2010). 123. Lara, F. A. et al. A new intracellular pathway of haem detoxification in the midgut of the cattle tick Boophilus microplus: aggregation inside a specialized organelle, the hemosome. J. Exp. Biol. 206,1707-1715 (2003). 124. Caffrey, C.R. & Ruppel, A. Cathepsin B-like activity predominates over cathepsin L-like activity in adult Schistosoma mansoni and S. japonicum. Parasitol. Res. 83, 632– 635 (1997). 125. Delcroix, M. et al. A multienzyme network functions in intestinal protein digestion by a platyhelminth parasite. J. Biol. Chem. 281, 39316–39329 (2006). 126. Guerrero, F. D. et al. BmiGI: a database of cDNAs expressed in Boophilus microplus, the tropical/southern cattle tick. Insect Biochem. Mol. Biol. 35, 585-595 (2005). 127. Weygoldt, P. Evolution and systematics of the Chelicerata. Exp. Appl. Acarol. 22, 63-79 (1998). 128. Donohue, K. V. et al. Neuropeptide signaling sequences identified by pyrosequencing of the American dog tick synganglion transcriptome during blood feeding and reproduction. Insect Biochem. Mol. Biol. 40, 79-90 (2010). 129. Egekwu, N., Sonenshine, D.E., Bissinger, B.W. & Roe, R.M. Transcriptome of the female synganglion of the black-legged tick Ixodes scapularis (Acari: Ixodidae) with comparison between Illumina and 454 systems. PLoS One 9:e102667 (2014). 130. Simo, L., Slovak, M., Park, Y. & Źitňan, D. Identification of a complex peptidergic neuroendocrine network in the hard tick Rhipicephalus appendiculatus. Cell Tissue Res. 335, 639–655 (2009). 131. Audsley, N. & Weaver, R. J. Neuropeptides associated with the regulation of feeding in insects. Gen. Comp. Endocrinol. 162, 93-104 (2009). 132. Luo, C. W. et al. Bursicon, the insect cuticle-hardening hormone, is a heterodimeric cysteine knot protein that activates G protein-coupled receptor LGR2. PNAS. 102, 2820-2825 (2005). 133. Wu, Q. & Brown, M. R. Signaling and function of insulin-like peptides in insects. Annu. Rev. Entomol. 51, 1–24 (2006). 134. Gu, S.H., Lin, J.L., Lin, P.L. & Chen, C.H. Insulin stimulates ecdysteroidogenesis by prothoracic glands in the silkworm, Bombyx mori. Insect Biochem. Mol. Biol., 39, 171-179 (2009). 135. Mulenga, A. & Khumthong, R. Silencing of three Amblyomma americanum (L.) insulin-like growth factor binding protein-related proteins prevents ticks from feeding to repletion. J. Exp. Biol. 231, 1153-1161 (2010). 136. Zhu, X. X. & Oliver, J. H. Jr. Cockroach allatostatin-like immunoreactivity in the synganglion of the American dog tick Dermacentor variabilis (Acari: Ixodidae). Exp. Appl. Acarol. 25, 1005-1013 (2001). 137. Lee, M. C., Schiffman, S. S. & Pappas, T. N. Role of neuropeptides in the regulation of feeding behavior: a review of cholecystokinin, bombesin, neuropeptide Y and galanin. Neurosci. Biobehav. Rev.18, 313-323 (1994). 138. Sauer, J. R., Essenberg, R. C. & Bowman, A. S. Salivary glands in ixodid ticks: control and mechanism of secretion. J. Insect Physiol. 46, 1069-1078 (2000). 139. Simo, L. M., Źitňan, D. & Park, Y. Two novel neuropeptides in innervations of the salivary glands of the black-legged tick, Ixodes scapularis: Myoinhibitory peptide and SIFamide. J. Comp. Neurol. 517, 551-563 (2009). 140. Yang, Y., Bajracharya, P., Castillo, P., Nachman, R. J. & Pietrantonio, P. V. Molecular and functional characterization of the first tick CAP2b (periviscerokinin) receptor from Rhipicephalus (Boophilus) microplus (Acari: Ixodidae). Gen. Comp. Endo. 194, 142–151 (2013). doi:10.1016/j.ygcen.2013.09.001 141. Yang, Y., Nachman, R.J. & Pietrantonio, P.V. Molecular and pharmacological characterization of the Chelicerata pyrokinin receptor from the southern cattle tick, Rhipicephalus (Boophilus) microplus. Insect Biochem. Mol. Biol. 60, 13–23 (2015). doi:10.1016/j.ibmb.2015.02.010 142. Neupert, S. et al. The neuropeptidomics of Ixodes scapularis synganglion, J. Proteomics. 72, 1040-1045 (2009). 143. Hill, C. A. et al. G protein-coupled receptors in Anopheles gambiae. Science 298, 176-178 (2002). 144. Nene, V. et al. Genome sequence of Aedes aegypti, a major arbovirus vector. Science 316, 1718-1723 (2007). 145. Vieira, F. G. & Rozas, J. Comparative genomics of the odorant-binding and chemosensory protein gene families across the Arthropoda: origin and evolutionary history of the chemosensory system. Genome Biol. Evol. 3, 476-490 (2011). 146. Starostina, E., Xu, A., Lin, H. & Pikielny, C. W. A Drosophila protein family implicated in pheromone perception is related to Tay-Sachs GM2-activator protein. J. Biol. Chem. 284, 585-594 (2009). 147. Foret, S. & Maleszka, R. Function and evolution of a gene family encoding odorant binding-like proteins in a social insect, the honey bee (Apis mellifera). Genome Res. 16, 1404-1413 (2006). 148. Foret, S., Wanner, K. W. & Maleszka, R. Chemosensory proteins in the honey bee: Insights from the annotated genome, comparative analyses and expressional profiling. Insect Biochem. Mol. Biol. 37, 19-28 (2007). 149. Gong, D. P. et al. Identification and expression pattern of the chemosensory protein gene family in the silkworm, Bombyx mori. Insect Biochem. Mol. Biol. 37, 266- 277 (2007). 150. Gong, D. P., Zhang, H. J., Zhao, P., Xia, Q. Y. & Xiang, Z. H. The odorant binding protein gene family from the genome of silkworm, Bombyx mori. BMC Genomics 10, 332 (2009). doi:10.1186/1471-2164-10-332. 151. Vieira, F. G., Sánchez-Gracia, A. & Rozas, J. Comparative genomic analysis of the odorant-binding protein family in 12 Drosophila genomes: purifying selection and birth-and-death evolution. Genome Biol. 8, R235 (2007). doi:10.1186/gb-2007-8-11- r235. 152. Flicek, P. et al. Ensembl 2008. Nucl. Acids Res 36, D707 (2008). doi:10.1093/nar/gkm988. 153. Soding, J. Protein homology detection by HMM-HMM comparison. Bioinformatics 21, 951-960 (2005). 154. Finn, R. D. et al. Pfam: clans, web tools and services. Nucl. Acids Res. 34, D247- D251 (2006). doi:10.1093/nar/gkj149. 155. Katoh, K., Kuma, K., Toh, H. & Miyata, T. MAFFT version 5: improvement in accuracy of multiple sequence alignment. Nucl. Acids Res. 33, 511-518 (2005). 156. Peñalva-Arana, D. C., Lynch, M. & Robertson, H. M. The chemoreceptor genes of the waterflea, Daphnia pulex: many Grs but no Ors. BMC Evol. Biol. 9, 79 (2009). doi:10.1186/1471-2148-9-79. 157. Robertson, J. A., Howard, L. A., Zinner, C. L. & Stemke, G. W. Comparison of 16S rRNA genes within the T960 and parvo biovars of ureaplasmas isolated from humans. Int. J. Syst. Bacteriol. 44, 836-838 (1994). 158. Stamatakis, A., RAxML-VI-HPC: maximum likelihood-based phylogenetic analyses with thousands of taxa and mixed models. Bioinformatics 22, 2688-2690 (2006). 159. Croset, V. et al. Ancient protostome origin of chemosensory ionotropic glutamate receptors and the evolution of insect taste and olfaction. PLoS Genetics 6, e1001064, (2010). doi:10.1371/journal.pgen.1001064. 160. Kozomara, A. & Griffiths-Jones, S. miRBase: integrating microRNA annotation and deep-sequencing data. Nucl. Acids Res. 39, D152-D157 (2011). doi:10.1093/nar/gkq1027. 161. Gerlach, D., Kriventseva, E. V., Rahman, N., Vejnar, C.E. & Zdobnov, E.M. miROrtho: Computational survey of microRNA genes. Nucleic Acids Res. 37:D111– D117, (2009). doi:10.1093/nar/gkn707. 162. Giraldo-Calderón, G. I. et al. VectorBase: an updated bioinformatics resource for invertebrate vectors and other organisms related with human diseases. Nuc. Acids Res. 43(Database issue), D707-13 (2015). 163. Grbić, M. et al. The genome of Tetranychus urticae reveals herbivorous pest adaptations. Nature 479, 487-492 (2011). 164. Kirkness, E. F. et al. Genome sequences of the human body louse and its primary endosymbiont provide insights into the permanent parasitic lifestyle. Proc. Natl. Acad. Sci. U.S.A. 107, 12168-12173 (2010). 165. Munderloh, U. & Kurtti, T. Formulation of medium for tick cell culture. Exp. Appl. Acarol. 7, 219-229 (1989). 166. Riley, C. P. et al. The Proteome Discovery Pipeline – A data analysis pipeline for mass spectrometry-based differential proteomics discovery. The Open Proteomics J. 3, 8-19 (2010). 167. Zhang, X., Asara, J. M., Adamec, J., Ouzzani, M. & Elmagarmid, A. K. Data preprocessing in liquid chromatography-mass spectrometry-based proteomics. Bioinformatics 21, 4054-4059 (2005). 168. Riley, C. P. et al. A large, consistent plasma proteomics data set from prospectively collected breast cancer patient and healthy volunteer samples. J. Transl. Med. 9, 80 (2011). 169. Kapp, E. A. et al. An evaluation, comparison, and accurate benchmarking of several publicly available MS/MS search algorithms: Sensitivity and specificity analysis. Proteomics 5, 3475-3490 (2005). 170. Munderloh, U. G. et al. Invasion and intracellular development of the human granulocytic ehrlichiosis agent in tick cell culture. J. Clin. Microbiol. 37, 2518–2524 (1999). 171. Villar, M. et al. Identification and characterization of Anaplasma phagocytophilum proteins involved in infection of the tick vector, Ixodes scapularis. PLOS ONE 10, e0137237 (2015). doi: 10.1371/journal.pone.0137237. 172. Bonzon-Kulichenko, E. et al. A robust method for quantitative high-throughput analysis of proteomes by 18O labeling. Mol. Cell Proteomics 10:M110 003335 (2011). doi:10.1074/mcp.M110.003335. 173. López-Ferrer, D. et al. Statistical model for large-scale peptide identification in databases from tandem mass spectra using SEQUEST. Anal Chem. 76, 6853-6860 (2004). 174. Navarro, P. & Vazquez, J. A. refined method to calculate false discovery rates for peptide identification using decoy databases. J. Proteome Res. 8, 1792-1796 (2009). 175. Catchen, J. M., Amores, A., Hohenlohe, P., Cresko, W. & Postlethwait, J. H. Stacks: building and genotyping Loci de novo from short-read sequences. G3 (Bethesda) 1,171-82 (2011). doi: 10.1534/g3.111.000240. 176. Catchen, J., Hohenlohe, P. A., Bassham, S., Amores, A. & Cresko, W. A. Stacks: an analysis tool set for population genomics. Mol Ecol. 22, 3124-3140 (2013). doi: 10.1111/mec.12354 177. Langmead, B. & Salzberg, S.L. Fast gapped-read alignment with Bowtie 2. Nat. Methods 9, 357-359 (2012). 178. Wright, S. Evolution and the Genetics of Population, Variability Within and Among Natural Populations. The University of Chicago Press, Chicago (1978). 179. Hohenlohe, P. A. et al. Population Genomics of Parallel Adaptation in Threespine Stickleback using Sequenced RAD Tags. PLoS Genet. 6: e1000862. doi:10.1371/journal.pgen.1000862 (2010). 180. Nielsen, R. et al. Darwinian and demographic forces affecting human protein coding genes Darwinian and demographic forces affecting human protein coding genes. Genome Research 19, 838–849 (2009). doi:10.1101/gr.088336.108 181. Weir, B. & Cockerham, C. C. Estimating F-Statistics for the Analysis of Population Structure. Evolution 38(6), 1358–1370 (1984). 182. Raj, A., Stephens, M. & Pritchard, J. K. fastSTRUCTURE: variational inference of population structure in large SNP data sets. Genetics 197:573-89. doi: 10.1534/genetics.114.164350 (2014). 183. Rosenberg, N. A., DISTRUCT: a program for the graphical display of population structure. Mol. Ecol. Notes 4, 137–138 (2004). 184. Buckingham, S. D., Pym, L. & Sattelle, D. B. Oocytes as an expression system for studying receptor / channel targets of drugs and pesticides. Methods in Molecular Biology 322, 331-345. (ed X. J. Liu) Humana Press Inc., Totowa, NJ, USA. (2006). 185. Guittard, E. et al. CYP18A1, a key enzyme of Drosophila steroid hormone inactivation, is essential for metamorphosis. Dev. Biol. 349, 35-45 (2011). doi: 10.1016/j.ydbio.2010.09.023. 186. Jongejan, F. & Uilenberg, G. The global importance of ticks. Parasitology 129(Suppl):S3-S14 (2004). doi: http://dx.doi.org/10.1017/S0031182004005967 187. Van Zee, P. et al. Tick genomics: the Ixodes genome project and beyond. Intl. J. Parasitol. 37 (12) 1297-1305 (2007).